AutoCAD 2002. Библия пользователя

  • Published on
    08-Dec-2016

  • View
    276

  • Download
    15

Transcript

  • AutoCAD 2002

  • AutoCAD 2002Bible

    Ellen Finkelstein

    Hungry Minds"Hungry Minds, Inc.

    Best-Selling Books Digital Downloads e-Books Answer Networks e-Newslcttcrs Branded Web Sites e-Leaming

    New York, NY Cleveland, OH Indianapolis, IN

  • AutoCAD 2002

    "" - 2003

  • 32.973.26-018.2.7559

    681.3.07

    ""

    . ..

    ..

    ..

    "" :info@dialektika.com, http://www.dialektika.com

    , .

    59 AutoCAD 2002. . : . . . : "", 2003. 1072 . : . . . .

    ISBN 5-8459-0321-1 (.)

    AutoCAD 2002 - () , . - , - . - AutoCAD. AutoCAD 2002 , -. , - , , ,, , . , , , -. - . AutoCAD. . , -, , . , - . - , - AutoCAD .

    32.973.26-018.2.75

    - .

    , , , Wiley Publishing, Inc.

    Copyright 2002 by Dialektika Computer Publishing.Original English language edition copyright 2002 by Wiley Publishing, Inc. All rights reserved including the

    right of reproduction in whole or in part in any form.This translation published by arrangement with Wiley Publishing, Inc

    ISBN 5-8459-0321-1 (.) - "", 2002ISBN 0-7645-3611-7 (.) Wiley Publishing, Inc., 2002

  • 22

    I. AUTOCAD 33

    1. 34

    2. 49

    3. AutoCAD 60

    4. 84

    5. 119

    II. 137

    6. 138

    7. 148

    8. 165

    9. : 203

    10. 234

    11. , , 292

    12. 327

    13. 348

    14. 380

    15. 425

    16. 463

    17. 510

    III. 549

    18. 550

    19. 597

    20. 618

  • IV. 653

    21. 654

    22. 678

    23. 724

    24. 763

    25. 818

    V. 851

    26. 852

    27. 880

    28. AutoCAD Internet 904

    VI. AUTOCAD 929

    29. 930

    30. - 948

    31. 960

    32. 971

    33. 982

    VII. AUTOCAD 1019

    VIII. 1021

    . AutoCAD 1022

    . AutoCAD 1048

    . - 1054

    1060

  • 21 22 23

    23 24 25 26 27 29 - 30 30 31

    32

    I. AUTOCAD 33

    1. 34 34 AutoCAD 35 36

    AutoCAD Today 36 AutoCAD Today 38

    AutoCAD 39 40 41 41 41

    , ! 42 42 42

    44 AutoCAD 47 48

    2. 49 , 49 50

    50 53

    , 54 54

    AutoCAD Today 54 AutoCAD 56 56

    57 57 59

    3. AutoCAD 60 AutoCAD 60

    AutoCAD 60 62

    7

  • 63 64

    67 67 AutoCAD 69

    AutoCAD 70 70 71 72 73 OOPS 74 75

    76 78

    AutoCAD 78 79 80 81 81

    82

    4. 84 84

    85 85

    86 86 87 88 "-" 91 91 91

    95 97

    97 102

    109 109 113 From 116

    117

    5. 119 119

    121 121 123

    125 126 127

    131 132

    132 SNAP, GRID ORTHO 134

    MVSETUP 135 136

    8

  • II. 137

    6. 138 LINE 138 141 142 145 146 147

    7. 148 148

    CIRCLE 148 149

    152 152 152

    156 156 158

    160 DONUT 161 161

    161 162 162

    164

    8. 165 AutoCAD 165

    REGEN REDRAW 166 166

    PAN 167 167

    ZOOM 169 ZOOM 170 Dynamic ZOOM 171

    Aerial View 174 175 Aerial View 175 Aerial View 176

    178 178 180 180

    181 181 182

    183 183 186 187

    190 192

    192 193

    9

  • 194 196

    198 198 199

    201

    9. : 203 203

    204 204 206 209 211 214 216 218

    221 221 227 227 230

    233

    10. 234 234

    MIRROR 235 ARRAY 236 242 244

    246 246 249 253 256

    258 259 CHAMFER 261 FILLET 265

    267 268

    269 271 272 272 273 276

    Object Property Manager 276 279

    Quick Select 279 FILTER 281 283 284 285

    287 287

    10

  • 289 290

    11. , , 292

    293 293 294 300 307

    , 313 313 315 315 316 316 317

    318 319 319 321

    323 323 326

    12. 327

    327 327 328 330

    332 332 333 333 334 Object Property Manager 337

    337 338 338

    AutoCAD 341 341 341 342 343 CAL 344

    347

    13. 348

    348 349 351 352 352 TEXT 354 355

    359

    11

  • 359 361 363 363 364

    365 Multiline Text Editor 365 369 370

    3 72 372 AutoCAD 373 373 MIRRTEXT 373

    375 376

    3 77 379

    14. 380 AutoCAD 380

    380 382

    383 , 383 DIMLINEAR 386

    390 391 DIMALIGNED 391

    393 394 394

    396 396 397 398

    398 402 - 405

    405 408

    410 413

    413 DIMEDIT 415 DIMTEDIT 416 DDEDIT 418 Object Property Manager 418 Quick Dimension 419 420 420

    424

    15. 425 425 427

    12

  • 428 430 433 437 442 444 446

    449 449 449 450 450 451 452 452 453

    457 458 460 460

    462

    16. 463

    463 PLINE 464 PEDIT 467 Properties 470

    471 472 474

    478 480 482

    483 484 486 490 491 SOLID 493

    493 494 499 500

    505 507 509

    17. 510

    510 510 511

    511 511 Layout Wizard 512 516

    528

    13

  • 529 530 535 plot style 536

    538 539 542 543 543 544 544 545 545

    548 548

    III. 549

    18. 550 551

    551 551 553 555 556

    558 Insert 558 AutoCAD DesignCenter 560

    564 564 568 XPLODE 568 570

    Windows 574 Windows 574 575

    577 578 582 583 590

    596

    19. 597 597

    598 601

    602 603 605

    607 607 608 609 610

    614

    14

  • Xref Manager 614AutoCAD DesignCenter 616 616

    617

    20. 618 618 620

    620 621 621

    626 626 627 Data View 631

    632 632 633

    639 639 640 641

    Query Editor 642 Quick Query 643 Range Query 644 Query Building 645 SQL Query 646 Link Select 649

    650 650 651 AutoCAD 2002 651

    652

    IV. 653

    21. 654 655

    AutoCAD 656 657 658 , 661 663

    664 664 HIDE 665 668

    670 670 UCS 672

    677

    22. 678 679

    VPOINT 680 680 DDVPOINT 686

    15

  • 688 ^ 692 695

    695 696

    3D Orbit 698 3D orbit 699 3D orbit 705

    711 711

    DVIEW 712 DVIEW 713

    720 SOLVIEW 720 SOLDRAW 722 SOLPROF 722

    723

    23. 724

    3DFACE 725 3DFACE 726 726

    PFACE 732 3DMESH 737 739

    740 741 742 743 744 745 746 746Mesh () 747

    751 751 752 REVSURF 752

    754 757 759 761

    24. 763

    764 765 766 767 768 769 770

    772 775 776

    776

    16

  • 777 778 INTERFERE 778

    782 SECTION 782 SLICE 783

    785 787 788 79 i 794 795 798 800 802

    803 804 811 812

    815 816

    25. , 818

    818 819 820

    821 822 823 823 824 826 827 830 834

    835 835 ' 842

    844 846

    848 849 850

    850

    V. 8S1

    26. 852 AutoCAD DesignCenter 852

    AutoCAD DesignCenter 853 857 DesignCenter 858

    860 AutoCAD Today 860 861

    17

  • 862 868

    872 872 873 AutoCAD 873 874

    AutoCAD 875 AutoCAD 875 876

    876 877 878 879

    , AutoCAD 879 879

    27. 880 881

    881 885

    886 887 888 889 890

    , 894 AutoCAD 894 897 899

    903

    28. AutoCAD Internet 904 904

    AutoCAD 904 FTP 905 905

    908 NetMeeting 908 910 910 912 912 NetMeeting 913

    Web 913 Browse the Web Open 913 i-drop 914

    915 915 , 917 918

    Web- 919 DWF- 919 DWF- 919 Publish to Web 921 Web- 925

    18

  • 925 928

    VI. AUTOCAD 929

    29. 930

    930 932 932 933 934

    935 Windows- 935 935

    937 Toolbars 938 938

    947

    30. - 948

    948 949 950

    - 954 955 955 - 956

    958 958

    31. 960

    960 960 962

    965 970

    32. 971

    971 972 972 979

    979 981

    33. 982

    982 983 983

    986 acad.mnu 987 988 990 991 994 997 1006

    19

  • 1007 1011 1012 1012 1014

    1018

    VII. AUTOCAD 1019

    VIII. 1021

    . AutoCAD 1022

    AutoCAD 1022 AutoCAD 1023 1024 1027 AutoCAD 1027

    AutoCAD 1028 Files 1028 Display ' 1029 Open and Save 1030 Plotting 1032 System 1033 User Preferences 1035 Drafting 1038 Selection 1039 Profiles 1039

    AutoCAD 1041 1041 ! 042 1043 , ] 044

    1044 Plotter Manager 1045 1046

    AutoCAD Today 1047

    . AutoCAD 1048

    AutoCAD 1048 1048 1049 1049 1049

    1049 AutoCAD 1050 Internet 1050

    . - 1054

    - 1054 Results 1055 Book PDF 1056 Reader - 1056 Links 1056 Software 1056

    1058

    1060

    20

  • (Ellen Finkelstein) AutoCAD , - . , AutoCAD, Microsoft Word, Excel Power Point. MicrosoftWord, Power Point Flash Hungry Minds, Inc. , - , AutoCAD for Dummies Quick Reference. - AutoCAD 13 Secrets. 1997 AutoCAD 14 Bible, 1999 AutoCAD 2000 Bible. "" AutoCAD 13 (1997 ), AutoCAD 14. (1998 ) AutoCAD 2000. (2000 ).

    21

  • Autodesk Customer Performance Improvement. : - . , . , , Autodesk.

    AutoCAD . AutoCAD 2002 ~ - -. , . , - . , - .

    . Autodesk - , . , Autodesk, - Customer Performance Improvement. , AutoCAD 2002, Hungry Minds, .

    , AutoCAD 2002. AutoCAD 2002. . - , AutoCAD, - AutoCAD Today Web- Autodesk Point . - , , , , , . , AutoCAD 2002. , .

    (Wayne Hodgins), Worldwide Learning Strategies Autodesk, Inc.

    22

  • AutoCAD 2002. ] Auto-

    CAD 2002 () , . , . - AutoCAD.

    AutoCAD 2002 "" AutoCAD. - , - . , , , - , , , . , - , , ( 2000i 2002). .

    AutoCAD AutoCAD 2002. . AutoCAD - . , -, . - , -. , AutoCAD . - AutoCAD ; - , . , -, AutoLISP-. , , AutoCAD 2002.

    AutoCAD 2002. - -

    AutoCAD, - , .

    AutoCAD, - , , , AutoLISP Visual Basic for Applications(VBA), , , AutoCAD. , .

    AutoCAD... AutoCAD 2002. -

    , AutoCAD.

    23

  • ...

    , - AutoCAD, -, 2002.

    ...

    AutoCAD , . , .

    AutoCAD 2002. .

    I. AutoCAD , , -

    . , - , AutoCAD , .

    II. , -

    () - , -, . .

    III. AutoCAD , -

    , . , - AutoCAD .

    IV.

    , -. - , .

    24

  • V. AutoCAD, -

    , . , -, AutoCAD , . - AutoCAD World Wide Web.

    VI. AutoCAD AutoCAD,

    - . , - , , , ,, , . - AutoCAD.

    VII. AutoCAD AutoLISP Visual LISP.

    Visual Basic for Applications.

    ; -

    AutoCAD ; , - AutoCAD; -; .

    AutoCAD 2002. ,

    .

    , , -

    . , - , . , - . , , . -, .

    25

  • ,

    . - , AutoCAD. .

    AutoCAD , - , , - . , AutoCAD , - III IV. , - -, I " ", , 2002. : , 2002 , , . .

    , . ,, , . , .

    , AutoCAD ,

    -. , , , - . , - . AutoCAD - , , -, . - , .

    , -. , - . , ( - ), . -, . - . , - , . . - , - - , .

    , -, . , . , - .. , - . , ,

    2

  • . . : .

    AutoCAD , . .

    AutoCAD 2002. -, , - - AutoCAD . , ( ), .

    , -

    .

    AutoCAD , -

    ( Windows), , , - *$. , " View^Paper S p a c e " , View AutoCAD ( View), Paper Space. , - , .

    AutoCAD , -, , . , . - ;" ( ...) Zoom Extends ( ) Zoom Standard". , , -, . -: -, ; -, -, ( ) - . : "", , Zoom? -, - . , , .

    AutoCAD, : , , . ( ) -. AutoCAD - , CIRCLE. AutoLISP VBA , COMMAND.

    27

  • AutoCAD,

    , , . , , . AutoCAD - , , -, . (, - ) . - . , X Y, , ,

  • Tools^Options,

    Line Draw,

    ,

    , . " ", ,

    , Enter, Return, J .

  • !

    , 2000J 2002 AutoCAD. , AutoCAD, 2002, .

    , .

    , AutoCAD . , , , - , .

    , - .

    , -*" 'I .-;.. , ,& *. -. -

    : , .

    !

    , , . , - - .

    - - , -

    . . - , , . , - AutoCAD, , -, . 15- AutoCAD 2002.

    AutoCAD, -

    , , , .

    , Windows, - , .

    30

  • , - Windows, , AutoCAD, Windows.

    , AutoCAD 2002. , , , AutoCAD, 20001. , ,, , AutoCAD 2000.

    AutoCAD 2002, Windows 98. -, Windows ME Windows NT/2000. . .

    .

    : e l lenf ink l@big foot .com. - Hungry Minds.

    31

  • {Tom Heine), .

    (Melba Hopper) , (Roxane Marini), - , Hungry Minds, . (Darren Young).

    (Bill Plante), (Leonid Nemirovsky), AutoLISP , (Alan Praysman), - ( -).

    , . - AutoCAD.

    -, . , , ( )... .

  • AutoCAD

    ,

    AutoCAD. , . AutoCAD , 2002. , - , -, II, " -", , - . , , - .

    %

    *?* 2. ' * . *". . . , " , - :

    ...

    '. 3.- _^:, ; , _ >1 - AutoCAD i f t : -n - :." . . ; V * s . '.- 4. '_ v;- ?'-> . :

    5." .-^-- :: "- : \ .; ?. - --'*'.;: .''$*.

    ^;,

    :

    :. f.?r .:* . ;.-.

  • JOSS

    AutoCAD - - :

    ? , , , , - AutoCAD, - , , . AutoCAD. , - . - , AutoCAD.

    AutoCAD, Autodesk,

    - - , - . Autodesk - . CAD (computer aided design), - (computer aided drafting anddrawing) .

    AutoCAD 1982 DOS. - , - . - , . AutoCAD

  • . , ASCII, . - AutoLlSP. AutoCAD .

    AutoCAD , . "" , , , AutoCAD - (). AutoCAD - 150 .

    , Autodesk, - . AutoCAD - , , - , , - .

    Autodesk , - , AutoCAD, -, - , AutoCAD, - , . AutoCAD .

    AutoCAD , :

    ; architectural, engineering, construction (, , );

    ;

    (Geographic Information Systems GIS);

    ;

    ;

    .

    , , , AutoCAD, - , . .

    , , AutoCAD - .

    , !

    AutoCAD AutoCAD,

    - . AutoCAD.

    1. 35

  • AutoCAD 2002, 15 , -. - \Software\AutoCAD 2002 Trial\Setup.EXE.

    AutoCAD 2002, - Windows 98, Windows ME, Windows NT 4.0 Windows 2000. , - AutoCAD. - AutoCAD , -, .

    AutoCAD , , " AutoCAD".

    , AutoCAD -, . 1.1.

    . 1.1. AutoCAD

    AutoCAD, . , StartsProg rams AutoCAD 2002 (1^ ^ AutoCAD 2002). , AutoCAD 2002.

    / AutoCAD AutoCAD Today (AutoCAD

    " ), . 1.2. AutoCAD. AutoCAD Today ,

    ! AutoCAD, Internet .

    AutoCAD Today AutoCAD Today .

    , (My Drawings ( )), . - ( , ).

    , Bulletin Board (-), Web- Internet . , AutoCAD - .

    Point , Autodesk Internet.

    36 I. AutoCAD

  • AutoCAD 2002 Todav

    SsiecihowJobegin [History(byDate) MondayJuneC4,2QQ1 J_ ____ Sunday,June03,2001 uAdd/Modify FTPLocations (1^/ FTP). Name of FTP site ( FTP) FTP, ( Anonymous ( ) User ()), . FTP -

    46 I. AutoCAD

  • (, , ). , , FTP, , .

    , - . -

    .

    , - Save In ( ). File Name ( ) Save, .

    , , - View (). List () - , Details () - , , Preview() .

    . 1. . Save () .

    Save Drawing As ( ).

    2. Save In ( ). , AutoCAD Bible .

    3. AutoCAD Bible, , .

    4. File Name ( ), -1 ( Save ()).

    AutoCAD abl- l .dwg. , - , , , , , . , 1, " ".

    - savea.lsp, - , . , . \Software\Chap01\Savea.

    AutoCAD

    AutoCAD. - Close () . File^Close (^).

    AutoCAD 2000, -; ~! , WindowClose (^

    -~ ). AutoCAD -! , .

    1. 47

  • , AutoCAD, Close () . -, Q u i t . - AutoCAD. , , - quit . File^Exit (^).

    - - , AutoCAD . -, , Yes (), , No (). , Cancel () . , AutoCAD .

    . AutoCAD1. a b l - 1 .dwg - -

    . Fi le^Close ( ). - , . ( , .)

    2, Close () - . AutoCAD , .

    AutoCAD

    . , - , , . AutoCAD.

    , , . : - . , , .

    48 I. AutoCAD

  • AutoCAD - ... . - -

    - . _. i . *' * ' ' 1 - " "

    ,

    . - AutoCAD , - , , Microsoft Word.

    , -, Create Drawings ( ) - AutoCAD Today. Se-lect how to begin (, ) Template (). - AutoCAD, . 2.1.

    , , - . , , . , , . - ACAD -Named P l o tS t y l e s . d w t . a c a d . d w t . (Acad AutoCAD.) , - ( ), - . , .

    - : . . . i f

    * " . i >

  • f y ACAD -Named Plot Styles doANSI A (portrait) -Color Dependant Plot aacad.OMACAC -Named PW SMee.flwtacad.mutACAOISO -Named Plot Styles a

    *.

    ANSI A (portrait) - Dependent Plot StAN3I -Named Plot Style*.

  • AutoCAD Express Tools Copyright e 2000 Autodesk, IncAutpCAD__enu..utilities__lo_eded

    Commend'

    Puc. 2.2, AutoCAD : Drawing2. dwg

    1. .

    2. , Save () .

    3. Save Drawing As ( ), - , Save as type ( ) AutoCAD Drawing Template File (*.dwt) ( ). Acad -Named P l o t S t y l e s , dwt. Save (). #

    4. , , Yes.

    5. Template Description ( ) . .

    .

    ^^1||-. Acad -fe I P Named Plot Sty les.dwt Acad.dwt,

    -. - - , , -, .

    2. 51

  • AutoCAD. Creative Edge] , .

    Creative Edge CAD/. - AutoCAD . . - Creative Edge , .

    ~~ - . , - , . (Rapid City, South Dakota), - Creative Edge (Harri Aalto) , AutoCAD. , - . , .

    . - , - .

    %;INW12.OUTF20 . 000;PRE-OFFSET

    G92XY

    G91

    G41

    HI

    N1177A

    GOX2.0787Y4.24 81;_RAPID_T0_PIECE

    /P20Q;_CUTTER_ON

    G91

    G3X.1764Y.012II.0821J.0942

    G3X.3383Y.39091-5 6.37 9 6J4 9.1335

    52 I. AutoCAD

  • Creative Edge 16 - . , , , . , , , , , , . , .

    , , (HarriAalto), - Creative Edge, , . .

    , ,

    . AutoCAD . , . , Acad -Named Plot S t y l e s . dwt . - , .

    1. Acad -Named P l o t S t y l e s . d w t , Save () - .

    2. Save Drawing As ( ), , Save as type ( ) - AutoCAD Drawing Template File (*.dwt).

    3. File Name ( ) Save ().

    4. Template Description ( ) - .

    AutoCAD -. .

    2. 53

  • , - -

    . , 4 | | ( 4), . ^ ^ tb-O.dwt,tb-l .dwt .. (^ We block ).

    ,

    , . , , . -, , - . , .

    , , Create Drawings AutoCAD Today Se-lect how to begin Start from Scratch ( ). .

    ,

    . AutoCAD Today, AutoCAD.

    AutoCAD Today , AutoCAD,

    AutoCAD Today Open Drawings ( ), . 2.3.

    WA.

    . 2.3. Open Drawings AutoCAD Today

    Select how to begin , .

    54 I. AutoCAD

  • Most Recently Used ( ) - , .

    History (by Date) ( ( )) - .

    History (by Filename) ( ( )) - .

    History (by Location) ( ( )) , - .

    , , , . , - , . , , .

    , Browse (). Select File ( ) . 2.4.

    . 2.4. AutoCAD Select File -, Open Windows

    Look in () ( ) , . (), , Look in. . . Preview ( ) - , , - . Open ().

    , , AutoCAD ( R12 -), . , AutoCAD R13 R14, , - .

    2. 55

  • baajv Web- Search the Web ( Web).?~ Windows F a v o r i t e s (), . - , Save As (). 1, " ".

    AutoCAD

    AutoCAD Open () . Select File. . AutoCAD 2000 - Windows Explorer. Windows Ex-plorer AutoCAD. , , - . AutoCAD , - ( ) .

    , AutoCAD DesignCenter, AutoCAD DesignCenter .

    AutoCAD DesignCenter, Explorer. . - Desktop. , . . Open in Window ( ).

    DesignCenter 26, " - "

    , , Select File, , Windows.

    Open.

    , , Windows . List() . Details( ) - , .

    , .

    56 I. AutoCAD

  • , , , . : , - , AutoCAD.

    a d l - l .dwg, , - , Results - -.

    . 1. AutoCAD , . AutoCAD

    Today Open Drawings, Browse.

    ^ 2. AutoCAD , Open () -?! .

    3. Look in () Select File () CD-ROM.

    4. R e s u l t s .

    5. . a b l - 1 .dwg ( - 9 .dwg).

    6. Open (). AutoCAD . .

    - . , - . . , - . , .

    , AutoCAD, . , - .

    -

    - . AutoCAD FileoSave As ( ), Save Draw-ing As ( ). File name ( ) . Save (). , Save in ( ...).

    2. 57

  • , - . - AutoCAD a b i - i .dwg - . ab 1-1. dwg Results, -.

    . 1. AutoCAD File=>Save As ( ). -

    Save Drawing As ( ).

    2. File name ( ) a b 2 - l . dwg. AutoCAD Bib le Save ().

    3. Line () Draw (). .

    Specify f i r s t point: 10,.5

  • ' j \ Siwe change ( L VhitoCAD Qllila nbZ-1 dwtf? j

    :. Tin 1 1^>?5* ! ! T

    . 2.6. AutoCAD , ,

    . , - . , -, .

    AutoCAD Acad -Named P l o tS t y l e s . dwt. . . - . - File^Save As AutoCAD.

    AutoCAD.

    2. 59

  • I AutoCAD

    ; ; .../ AutoCAD

    AutoCAD

    * ere

    ?,

    , AutoCAD, -

    . , , , . .

    - AutoCAD, - . , , , -, , , . AutoCAD , .

    AutoCAD

    - , - , -, .

    AutoCAD Windows -

    -, AutoCAD , , -, - . - AutoCAD Windows-.

  • i

    I

    AutoCAD image (), - Autodesk CAD Overlay. AutoCAD .

    AutoCAD, DOS, - , . -, , , Windows- , Windows-.

    , , , -, . - AutoCAD Tools Options (^) - Display () . Display screen menu ( ) .

    AutoCAD . - Windows-.

    Windows-, . . . 3.1.

    3.1, AutoCAD

    (...)

    . 3.1 View () .

    -Zoom ''--;^: ", ... ,A*riaiVl*wV> '

    3D Vim3DOrfcli ,

    Shade

    Dbpjay

    -

    -

    -

    . 3.1. View

    3. AutoCAD 61

  • - . ab2-i .dwg, - Results -. - - , .

    . 1. a b 2 - l . dwg R e s u l t s -.

    2. View () Zoom (-). , . .

    3. . - ZOOM ().

    4. Out (). , .

    .

    , -, . ZOOM . , Zoom. , Out, , - . , - S c a l e () 0 . 5. , .

    AutoCAD

    . , , , - . - .

    - -,

    ". Windows - - Cut (), (), Pas te() - AutoCAD Undo, - Pan, () Zoom, .

    - , - .

    - AutoCAD ( , - ), - . AutoCAD .

    , .

    62 I. AutoCAD

  • . - , .

    AutoCAD . .

    AutoCAD . -

    . - .

    , Windows-, - AutoCAD - . , AutoCAD - , -, . , AutoCAD .

    Drawing Units ( ), , - (. 3.2). , AutoCAD.

    oautCEooooo . " ^ . *;

    . 3.2. - Drawing Units AutoCAD

    . 1. .

    2. AutoCAD FormatOUnits (=>). - Drawing Units ( ). : Length () Angle ().

    3. , - , Decimal (). Architectural (). : - Precision () .

    3. AutoCAD 63

  • 4. ( ) , .

    5. Decimal.

    6. Precision (). - (0.0000). (0.00).

    7. Angle, - . , - Sample Output ( ).

    8. Decimal Degrees ( ).

    9. Precision .

    10. : Direction () - (...) , . . Direction , Direction Control( ). -, 0, - 90 .. , - .

    11. Cancel (), , . , . Cancel Drawing Units. , , Clockwise( ), .

    12. Precision () 0 - . , Precision .

    13. Precision 0.0000 - . , .

    14. . - , - , Cancel. - , .

    - (?), , -

    . , -"?!!% .

    AutoCAD

    . , ., , -

    64 I. AutoCAD

  • , , . , AutoCAD.

    AutoCAD . - , . , 29, " ".

    AutoCAD 26 . : Standard (), Object Properties( ), Draw () Modify (). .

    , , - ( ) , . , , (). , - . Toolbars (), View^> Tool bars (^). , .

    (, , ) . - , "" -, , "" - .

    , - . - - - .

    . 1.

    Draw (), , , Object Properties ( ) ( - , ). . - , Draw "" Object Properties.

    2. Modify () ObjectProperties, "" . AutoCAD , . 3.3.

    . 3.3. Draw Modify

    3. AutoCAD 65

  • 3. . - , Draw, , - , -, .

    4. Modify . AutoCAD , . 3.4.

    t i

    . 3.4. Draw Modify

    5. . - Dimension () - . Dimen-sion (), AutoCAD, . , . , .

    6. . - , R a d i u s D i m e n s i o n (- ). .

    7. . .

    8. , . , .

    9. ( ). , , , . "" (. 3.5). - , .

    66 I. AutoCAD

  • !?

    -I

    "

    /'. 5.5. Dimension -

    10. , , , , - . , Close (). , Dimension.

    11. Draw Modify , "" -, .

    , , , , - , . , , .

    , , AutoCAD -

    , , - , . , . - ZOOM, 1, " ".

    AutoCAD .

    ( , -

    3. AutoCAD 67

  • ). , . -, , AutoCAD, , , "" , . - . -, .

    , LINE() ARC (). , HATCHEDIT (), DDPTYPE () IMAGEATTACH(). .

    . 29, " ".

    , ( ) , , - . . 3.2 , - AutoCAD.

    3.2.

    / . : AutoCAD ,

    - . , -, . , AutoCAD . , . , , . , Paste To CmdLine( ). AutoCAD - . . RecentCommands ( ) -, .

    68 I. AutoCAD

  • . -

    %. | 0 ( 4, " "), - , .. -

    . - , ( 1, " "), , .

    AutoCAD AutoCAD ,

    . :

    [] :

    , . , , AutoCAD S e l e c t Objects (- ). , , , .

    -. .

    , AutoCAD , (, , ). - ( ) , .

    , (, ()), AutoCAD - . , .

    , - .

    , . 1, " ", - . .

    . AutoCAD1. Acad -Named P l o t S t y l e s , dwt.

    | 2. Arc () Draw ().

    ^ ^ 3. : Specify s t a r t p o i n tof a rc or [CEnter ] :. , - AutoCAD . - . - . .

    4. : Specify second p o i n t ofarc or [CEnter/ENd] :. , . ,

    3. AutoCAD 69

  • , , - , . 3.6. End (). Auto-CAD : spec i fy end p o i n t of a r c : .

    . 3.6. End ARC

    ;11""

    5. .

    6. : Speci fy c e n t e r p o i n t of a r c or[Angle/Direct ion/Radius] :

  • AutoCAD 2000 - . - . Command:, - . AutoCAD . AutoCAD , , . . Tools'^Options ( ) User Preferences ( ), Right-click Customization ( ).

    , - , ,

    -. , . -'" .

    , (, ), . multiple^ (). E n t e r command name to r e p e a t : , . -. , . , multiple^, , , arc, - . , Command: _ a r c .

    , -

    . Command:. AutoCAD.

    . AutoCAD1. Acad -Named P l o t S t y l e s , dwt.

    2. Circle () Draw.

    3. : Specify c e n t e r p o i n tfor c i r c l e or [3P/2P/Ttr (tan tan rad ius) ] :. - , .

    4. Specify r a d i u s ofc i r c l e or [Diameter] :. -, . AutoCAD .

    5. . CIRCLE.

    6. :Specify center point for c i r c l e or [3P/2P/Ttr (tan tan r a d i u s ) ] : 2Specify first end point of circle's diameter:

    . AutoCAD 71

  • Specify second end point of c i r c l e ' s d iameter :

    AutoCAD *Cancel* (**) - Command:. , .

    .

    Windows -

    . , - Undo () Redo () . AutoCAD . , - , . AutoCAD "" , . , , - .

    , . , , . "" - .

    ^ ^ ^ .

    U Undo ()

    AutoCAD . -, :

    Everything has been undone

    AutoCAD - . AutoCAD () UNDO(). Undo U, () .

    UNDO UNDO .

    . - :

    Enter the number of operations to undo or[Auto/Control/BEgin/End/Mark/Back]:

    Number. , - 3, AutoCAD . 1 U. . 3.3.

    72 I. AutoCAD

  • 3.3. U N D O

    Auto () ON () O F F (). , . ( ON), , - , . , - . ( OFF), TO AutoCAD

    c o n t r o l . -() (),

    . None () UNDO() AutoCAD, . One - , .. UNDO

    B e g i n End ().() ( -

    ). , , UNDO End, . -

    End () , U N D O B e g i n

    Mark () Back (). Mark-Back Begin-End,

    Back , -() Mark UNDO, UNDO

    Back

    AutoCAD , , . Group (). . .

    Back Mark , . AutoCAD ;

    This w i l l undo every th ing . OK?

  • . 1. Acad -Named P l o t S t y l e s , dwt.

    2. Line () Draw ().

    3. , - .

    4. Arc () Draw ().

    5. , , .

    6. Circle () Draw ().

    7. , , , , . ( - ) , . . 3.7. , - -, - , .

    . 3.7. ,

    8. Undo . .

    9. undo . 2

  • AutoCAD . . "" . , , - , .

    - .

    a b l - l . d w g , - Results -.

    . 1. -

    . , Acad -Named P l o t S t y l e s . dwt .

    2. View^Zoom^Out ( ^ 1^ ). - .5 ). (, , ):

    Specify corner of window, enter a scale factor (nX or nXP), or[All/Center/Dynamic/Extents/Previous/Scale/Window] :2xResuming CIRCLE command.Specify radius of circle or [Diameter]:

    7. , , -, . a b l - 1 .dwg Window ().

    8. Tools^lnquiry^List ( ). - S e l e c t o b j e c t s : ( )

    3. AutoCAD 75

  • . S e l e c t o b j e c t s : - . AutoCAD , . - , 7 .

    9. Window d r a w i n g l . dwg.

    10. 7

  • . 3.8.

    . 3.9.

    ," AutoCAD".

    3. AutoCAD 77

  • AutoCAD -

    , . . , , Internet.

    Internet, - AutoCAD, , " AutoCAD".

    AutoCAD

    , - . , -. . ZOOM. , zoom>J

    & Standard loator:|E]

    View menu: Zoom

    Shortcut rnBnu:VWh no oBjects selected, right-click inthe drawing tree and cnoose Zoom to loom inreal tine.

    Command line: zoom (or 'zoom tor transparent use)

    Specify corner of window, enter a a r i l e factor (nXernXP),

    pynamle fortente/Pr e ilouscate WlndowlTeal lime >.

    . 3.10. - ZOOM

    , . , AutoCAD - .

    78 I. AutoCAD

  • , . . , , .

    Help^Help User Documentation

    ( ) . 3.11, Contents(). AutoCAD, - Command Reference ( ) Contents. - " , ", User's Guide ( ). , "+", . -, , .

    it? AutoCAD ?0D2 Help- User Pocumeiitdtiuii* P

    4 > Getting inlormationUser's Guide

    < i Commend Reference( i Driver end Peripheral Guidet S Customization Guide< k Visual LISP, AuJoUSP. nd DXFi i AcliveX and VBA Support Assistance

    A u t o C A D 2 0 0 2 H e l p

    Welcome to AutoCAD 2002 Help, which providescomplete information for using AutoCAD Click thefollowing l inks or use the Contents tab to browse Helptopics.

    Getting I n t i m a t i o n

    Provides information about using the Help system as

    well as a link to the AutoCAD 2002 Readme.

    " User's Guiiie

    Explains AutoCAD concepts, provides step-by-step

    procedures and associated c o m m a n d s , and includes

    a glossary with definitions of AutoCAD terms.

    Command Reference

    Provides a comprehensive reference to all AutoCAD

    commands and system variables

    Driver ami Per Miner ai Guiite

    Provides information about plotters and pi oiler

    . 3.11. , Con-tents AutoCAD 2002

    AutoCAD , .

    Contents Contents . .

    - , . , .

    Index - , -

    , . Index ( -

    3. AutoCAD 79

  • ) . , . , , -, . , . , , , Display(). , - .

    Search Search ()

    . , , List Topics ( ). - .

    Favorites Favorites (). -

    , Favorites Add (). Favorites, .

    Ask Me Ask Me ( ) AutoCAD -

    , , . , , . , .

    , , :

    Concepts ( ), ;

    Procedures () ;

    Reference () , .

    , , . . 3.4.

    ' -Jf ' :"['-" " -"- . '

    3.4. .

    Hide/Show , (/) . ,

    Back () ,

    Print () Options () , -

    80 I. AutoCAD

  • With LINE, you can create a series ofcontiguous l>ne segments. Each singleline segment can be edited separatelyfrom the other line segments in a sens*.You can close e sequence of linesegment* so that the first and lastsegments are joined.

    AutoCAD 2002 . -

    - , . , , . , - , . , - Help"=>Active Assistance (1^ ). . 3.12 , - LINE.

    , , .

    - , . , - .

    . , - . 3.12. , - Show Active Assistance ( - ).

    . , , , Hover Help, Settings (). Hover Help .

    . - Exit (). , , .

    Help ,

    .

    What's New ( ) , 2000, . , - AutoCAD .

    Learning Assistance (-) -.

    Support Assistance () , , , - , - . . - Web- Autodesk. - , .

    3. AutoCAD 81

  • Product support on Point ( Point A) Point A Autodesk. , Internet. - , - , .

    AutoCAD - . , What's New,

    . AutoCAD

    1. AutoCAD, . Acad -Named P l o t S t y l e s .dwt. -, .

    2. Circle Draw. . , CIRCLE.

    3. 2, -. , 2 2 Points (CIRCLE), . .

    4. Close () . , CIRCLE.

    5. Helpc?Help (^).

    6. Content (), . - User's Guide. The User Interface( ), "+", Menus and Toolbars ( ).

    7. Shortcut Menus ( ). , - .

    8. Procedures () . display a shortcut menu ( ) .

    9. Index ().

    10. transparent commands Display ().

    11. Topics Found ( ) ExecutingCommands ( ).

    12. , , , - Using Transparent Commands ( ).

    13. . , , Close() .

    AutoCAD. -

    , , - Windows. , -

    82 I AutoCAD

  • Command:. , - Command: .

    AutoCAD (, , ). , "" . "" , .. .

    AutoCAD . , .

    AutoCAD.

    3. AutoCAD 83

  • 7 |"

    ..

    i- -

    - I'I*..1" -i

    -

    , AutoCAD

    . , - , , . . , AutoCAD - .

    , , -, -. X Y. - AutoCAD.

    - UCS (User Coordinate System , ), , . 4.1.

    . 8, " - ".

    . 4.1. UCS - X

    , X, ( X -), , Y, - . , , , , - .

  • , () X Y. - .

    1, " ", AutoCAD : X, (,) Y. . 1.4 1.

    X Y 0,0. X, , , - Y.

    ? ,

    . AutoCAD . , , , , . , , - , "" , - . 33 33 .

    , .., ,, , , . - 5, " ". , , 17, " ".

    AutoCAD . , , . , , 120 . , 120 . , , - , , , . , .

    ,

    , , - , , .. .

    AutoCAD -Tia () , ,

    . - , , , .. . (-). , 3'21/2" 3'2-1/2", (") , AutoCAD "", (')

    4. 85

  • . : - 3'-2 1/2", .. , , . .

    , -

    . AutoCAD . .

    AutoCAD LINE ()

    , . 0,0. , , .

    . 1. Start from Scratch

    English ().

    2. Line () Draw () - :

    Specify first point:: -10,-5

  • AutoCAD i n v a l i d P o i n t P o i n t or o p t i o n keyword r e q u i r e d , , . - . UNDO () .

    4. LINE () :

    Specify f irst point: -8,-2Specify next point or [Undo]: 19,-2

  • , - @. , , , , , - , @2,0. AutoCAD - , . - . 4.4. , - Y 0. , Y .

    I = @2,0

    . 4.4. , , - @2,0

    , , , . - .

    , AutoCAD "", - . , . . 4.5 - - .

    . 4.5. , - , -

    -

    . , -. .

    88 I. AutoCAD

  • Specify next point orSpecify next point orSpecify next point or

    - .

    ~." . , . ,:::|||| , -

    Undo () .

    3. Line () Draw () - :

    Command: _line Specify first point:

    Specify next point or [Undo]: Q0,-3/4

  • "-"

    - . , S p e c i f y n e x t p o i n t or [Undo] : ( []:) - . , .

    ^0^1* - LINE, , -

    .

    , , , ..

    0, 90, 180 270, . AutoCAD - ( ORTHO), - . , . , - -. ORTHO - . - .

    ORTHO . ORTHO (, , , ). , , - . .

    ^00* , Tla . -

    , AutoCAD .

    ""

    ( - polar angles). 0, 90, 180 270, -. , - , - , "" (ToolTip), (. 4.8).

    4. 91

  • . 4.8.

    - . - . ToolsODraftingSettings (^ ) POLAR () Set-tings (). AutoCAD Drafting Settings (), Polar Tracking ( ) . 4.9.

    jHJDraHini) Settings1 * * > ! ,

    I . " * *

    aft " * * I V .-* * ! . 4 1

    1 a c ^ . i n c a l p d i

    v i ; i

    -4fAii

    *

    Puc. 4.9. Polar Tracking Drafting Settings

    , , Increment angle ( ) -. 90 5, ..

    92 I. AutoCAD

  • , 5. - . Additionalangles ( ), New (). . 10. , , . , - 35, AutoCAD 70 . , , , Delete ().

    Polar Tracking , ( Object Snap Tracking Settings). , Polar Tracking, .

    , : ( Track using all polar anglesettings) ( Track orthogonally only). , Polar angle measurement, , , - 0 ( Absolute), , - ( Relative to last segment). .

    Options () - Options (), Drafting (). AutoTracking Settings - .

    Display polar tracking vector - . , .

    AutoTracking ToolTip - - .

    , AutoCAD , Polar Tracking On Polar Tracking Drafting Settings. , POLAR .

    - , -, , - . - , . , . , - . AutoCAD - ( , - ) , . -, , , .

    4. 93

  • NumLock . .

    , . LINE, - . , , (

  • J. 4.10. , . - -

    11. ( 270) 1.5

  • . 4.12.

    , - (. 4.13). .

    . 4.13.

    , - (. 4.14). , - , .

    . 4.14.

    .

    .

    .

    .

    Z , - X Y. 0.

    , .

    .

    .

    1. . . , .

    2. . , - .

    3. . . ( ).

    4. . : .

    5. LINE.

    6. , S p e c i f y f i r s t p o i n t : .

    7. , , - . .

    8. .

    9. . , , . .

    96 I. AutoCAD

  • 10. , , - .

    11. - .

    12. - LINE. , , .

    .

    . AutoCAD . 14, AutoCAD -

    . 5% . - . AutoCAD Tools^Options(^) Display (). Crosshair size ( -) . .

    SNAP () , ,

    , . - , . . , - 0,25 . , , 0,25.

    , -. .

    AutoCAD 2002 (grid snap) (polar snap).

    , , -

    . - GRID (), . , .

    AutoCAD Tools^Drafting Settings (^ ) - SNAP () - Settings (). AutoCAD Draft-ing Settings ( ), Snap and Grid ( ) . 4.15. X Y Snap X Spacing ( X) Snap Y Spacing ( Y) Grid. Grid snap ( ) Rectangular snap ( ) Snap type & style ( -). . .

    4. 97

  • . 4.15. Snap and Grid Drafting Settings

    , . 8, " ", , - . , - . 8.

    , . X AutoCAD Y. Y, - Snap Y Spacing.

    ( Snap On ()). SNAP () . ( -) .

    ,

    , , - (: Increment angle( ) Polar Tracking Drafting Settings).

    , , .

    1. Drafting Settings ( ), Snap and Grid, .

    2. Polar snap ( ) Snap type &style ( ), . 4.15.

    3. Polar distance () .

    4. SNAP ( Snap On , , ).

    98 I. AutoCAD

  • , . - . . .

    SNAP . -

    , -*%# .

    , -

    (. 4.16). , GRID () . , . , , . 4.16 0.5 , . , - . , .

    :-. 4.16. . 6 . (Henry Dearborn),1, ,

    , . - AutoCAD G r i d t o o d e n s e tod i s p l a y ( ) .

    , , -, , .

    i

    ,

    . , -*% , 4-5 .

    4. 99

  • AutoCAD Tools^Drafting Settings SNAP () Settings (). - AutoCAD Drafting Settings Snapand Grid ( ) (. . 4.15). Grid () X Y XSpacing ( X) Y Spacing ( Y) .

    , , . X AutoCAD - Y. - Y, Y Spacing.

    - ( On () Grid). - GRID .

    ab4-b.dwg, - Drawings -.

    .

    1. 4-. dwg, -.

    2. AutoCAD File^Save As AutoCAD B i b l e ab4-4 .dwg.

    3. AutoCAD Tools^Drafting Settings SNAP - Settings (). AutoCAD Drafting Settings Snap and Grid.

    4. Snap () X X Spacing .5. : YSpacing X Spacing.

    5. Grid X Spacing ( X) X .5 .

    6. SNAP, GRID ORTHO. . OSNAP OTRACK .

    7. View^Zoom^AII (1^^).

    8. - . , . : 0.5, .

    9. LINE Speci fy f i r s t p o i n t : - 2 .000,2 .000, - ( Z, 0.0000).

    100 I. AutoCAD

  • 10. . , - .

    11. , 8.5000. ( ). 8.5 .

    12. LINE.

    13. , -. 10.5000,2.0000.

    14. , - 0.5 . Repeat Line ( ) LINE. - 1.50000,1.5000, :.5

  • 45, 3.5000 |

    j 1 2 0 5 0

    " - j

    .*' ":.-

    1 : . ^ o r . 1 " -

    r l x i

    ~ ; . r

    ' ]

    -

    L J

    /. 5.2. Drawing Units

    - - Units. - , Precision (-) -. Next ().

    -, , - AutoCAD Format^Units (^). Drawing Units (), . 5.2.

    Length() Angle (). - , .

    Precision () Length (), . , - , AutoCAD Design Center.

    3, " AutoCAD", - . 18, " ", - DesignCenter. DesignCenter - 26, " ".

    AutoCAD - . , - ( - Decimal). 3.25 , , 3.254. AutoCAD 3.254 . , - , 3.25, -. , "" . Precision , .

    (. 5.3). , -

    . AutoCAD DecimalDegrees ( ). . 5.2.

    5. 121

  • Advanced Setup

    i i -

    w -*'

    /*. 5..

    5.2.

    32.50

    3230'0"

    36.1111

    0.5672

    N 57d30- E

    ,

    , ,

    Decimal Degrees ( )

    Deg/Min/Sec (//)

    Grads ()

    Radians ()

    Surveyor ()

    1/60 , 1/60 . , .

    1/100 . , : . ' 0 2, 0 360,

    . 57.32. (, N Z) , ( W).

    Precision() .

    , Next. , , DrawingUnits, . 5.2. , Auto-CAD Format^Units (^).

    , . , -, Dimension Styles (- ). 15, " ".

    122 /. AutoCAD

  • , - (. 5.4).

    . 5.4.

    AutoCAD , ( -). AutoCAD.

    , -. , Next.

    - , Draw-ing Units ( ) Di-rection (). Direction Control ( ) . 5.5.

    , - .

    AutoCAD - (. 5.6).

    . ,

    . 5.5. Di-rection Control

    , . . - , Next.

    ^*** , - ,

    . - , - ( ). 8," ", , - .

    , 7

    5. 123

  • . 5.6.

    - Drawing Units.

    . Drawing Units1. Acad -Named P l o t S t y l e s , dwt.

    2. AutoCAD B i b l e ab5- l .dwg.

    3. AutoCAD Format^Units. Drawing Units.

    4. Length () Architectural ().

    5. Precision () '- 1/8".

    6. Deg/Min/Sec (//).

    7. Precision OdOO1.

    8. Drawing Units for DesignCenter Blocks ( - DesignCenter) Inches ().

    9. .

    10. LINE () :

    Specify f i rs t point: 2,2

  • Advanced Setup Wizard

    (. 5.7). AutoCAD - (drawing limits). XY, . - , .

    Advanced Setup

    'utfi. . .

    . 5.7.

    0,0 . , - . , - . Advanced Setup Wizard , , ( ) ( ) Width Length. , , , AutoCAD - , , - . , ( ), , , , (, ), .. , ( ), .

    , -. , . , 40 ( X) 30 ( Y), - 480,360. , 500,380.

    5. 125

  • AutoCAD . , ,

    , . - , . ZOOM () A l l (). - , ( , ; - , , ).

    , -

    Width Length Area (. . 5.7). , AutoCAD . Finish ().

    . AutoCAD Formats Drawing Limits (1^ ). - AutoCAD LIMITS (). - 0,0. . , - , .

    ab5-l.dwg, - Results -.

    . 1. AutoCAD , -

    5 - 1 . dwg. 5-1 .dwg -. R e s u l t s .

    2. AutoCAD Bib le ab5-2 .dwg.

    3. AutoCAD Format^Drawing Limits.

    4. .

    5. @16,10< .

    6. LINE :

    Specify f i r s t point: 0,0

  • , -

    . . , .. , . . 5.8 . , - , - . , - , .

    . 5.8. , , , . : (Henry Dearborn), AIA, (. )

    . . AutoCAD GIS(Geographical Information System), , - . , - , .

    , , ( ). , , .. - . .

    AutoCAD , . , , -, . .

    ., , - , - . -

    5. 127

  • , , . , 1/2 (1 ) , 1 (2,5 ) , - . . 5.3 5.4 , , .

    1. , 17, " ".

    5.3% , *"'/ . ; ( )

    1 = 279 87 = 216

    17" = 432 11" = 279

    22" = 558 17" = 432

    D 34" = 864 22" = 558

    44" = 1118 34" = 864

    5.4. * ;;,:;: ( )

    4 297 210

    A3 420 297

    2 594 420

    1 841 1 594

    1189 841

    = .

    AutoCAD (.. - ), -, , . %"= , V4" , , -, .. , AutoCAD. -. 1 74 .

    , - . , -, , -, - , 1. . (4"=) :

    128 I. AutoCAD

  • 74"=; '/4"=12" ( 12");

    1 "=48" ( 4).

    , 48. , '/48 .

    . - 4 ( 102 ). , 8'/211 (216x279 ), - 2"=1". , 2 1 , , , AutoCAD. - :

    2=;

    =72".

    V2. , - .

    ( 13, " ") ( 15, " ").

    AutoCAD . - , (, , - AutoCAD , - ). . 5.5 -, .

    . 5.5.

    ( AutoCAD)_ _

    (240){192)(96)(48)(24)(16)(12)(4)(2)

    J1)

    , - ( - ). . 5.6.

    5. 129

    /"

    Vie"

    V

    7*

    72"

    7

  • (

    120240360480

    6007209601200

    1"

    1

    (

    10'

    20'30'40'50'

    60'80'100'

    . 5.7 , , . , , , ..

    ( AutoCAD)

    5 000

    2 000

    1000

    500

    200

    100

    75

    50

    20

    1051

    1 5 000

    2 000

    1000

    500

    200

    1007550201051

    , , , -

    , . , - , . , . , - . , -, . , , .

    130 I. AutoCAD

  • , . 5.8, AutoCAD 175' - 120' . , -, 74"= '/8"=. , , . , , , , - , .

    . , . 5.8.

    . 1. '/4"=

    AutoCAD, 175'. , , 43'/4".

    2. , , - 30".

    3. . 5.3 22"17", .. , 43'/4"30".

    4. '/8"=. , 217/8", 15".

    5. ( , ) 21"16". , (7/") . - AutoCAD, , - . - .

    6. . Vg"=r : /"12", -, 96 ( 8x12).

    , AutoCAD. - . AutoCAD , .

    (title block)

    , , -, .. .

    AutoCAD Use a Template ( ), , . , Ansi a -named p l o t s t y l e s .dwt . Layout, - 17, ".

    5. 131

  • , - . Insert^Block (1* ). In-sert () . , Browse () - . ., AutoCAD, \Template AutoCAD 2002. 0,0 Specify On-screen ( ). Explode (), - . .

    2, " ", , , - . 18, " ".

    , , -

    . - , .

    AutoCAD, , . .

    . , , , , .. - 11, " , , ".

    ( 13, " ") - , .

    , ( 15, " ").

    AutoCAD -

    , , AutoCAD Windows. (blips) , - - . AutoCAD , .

    ab5-2.dwg, - Results -.

    132 I. AutoCAD

  • .

    1. AutoCAD , - ab5-2 .dwg. 5-2 . dwg -. R e s u l t s .

    2. AutoCAD Bib le a b 5 - 3 . dwg.

    3. blip mode

  • SNAP, GRID ORTHO AutoCAD,

    , , . - . , .

    , , ( ) .. Windows. - AutoCAD , .

    ab5-2.dwg, - Results -.

    .

    1. ab5-3.dwg 5-3. R e s u l t s -.

    2. AutoCAD B i b l e ab5-4 . dwg.

    3. AutoCAD Tools^Drafting Settings (^ -).

    4. Snap and Grid ( ) 0'0-1/2". Grid () XSpacing ( X) '. Snap Type ( ) Grid snap( ) Rectangular (). .

    5. SNAP () GRID () , - . OSNAP () .

    6. Format=>Units (=> ). Drawing Units ( ). Angle (decimal degrees). Drawing units for DesignCenter blocks ( DesignCenter) Inches (). .

    7. , 21/2,11/2 @1/2

  • , Save as type ( -) Drawing Template File (*.dwt) ( ). AutoCAD - \Template .

    10. File name ( ) a r c h r o o f . dwt. Save ().

    . Template Description ( ) : Arch units, 16,10 limits,blips, snap&grid ( .; 16,10; . ; ).

    12. File^New (1*). Usea Template ( ). a r c h r o o f . dwt. AutoCAD .

    .

    . 5.9.

    MVSETUP MVSETUP () -

    , .

    . 17, " ".

    , - , Quick Setup Wizard, . , mvsetup. AutoCAD - -:

    Enable paper space? [No/Yes] :

  • Enter units type[Scientific/Decimal/Engineering/Architectural/Metrie] :

    , . AutoCAD - , . E n t e r t h e s c a l e f a c t o r : ( ) .

    , AutoCAD ( ):

    Enter the paper width:Enter the paper height:

    , . Auto-CAD .

    . -

    , AutoCAD - . , . , , . , - . , .

    I, " AutoCAD", , - AutoCAD. , , - , II," ", () , .

    136 I. AutoCAD

  • , , . - II - AutoCAD. , , . , AutoCAD . - , - , .

  • , -

    . - LINE (), - .

    LINE Line () Draw (). S p e c i f y f i r s t

    p o i n t : ( :) -. , - . , . - Enter ().

    LINE , . - AutoCAD - - .

    AutoCAD - . -.

    - S p e c i f y n e x t p o i n t or[Undo] : ( []:).

    - . - . Undo () (

  • Specify n e x t p o i n t or [Close/Undo] : ( [/]:). Close () (
  • 11, " , , - ", , AutoCAD , \ 16, " ", -

    AutoCAD, , , .

    AutoCAD

    TEA (Transportation Engineering Agency) , - . - . Ports for National Defense Publications ( ). , . - , - , .

    - , , . - . - , , , . TEA MicroStation, Autodesk.

    (Paul Burgener) , - , , . -, AutoCAD. . .

    , WMF, TEA Microsoft Word for Windows FrameMaker .

    Ihricfeim

    N

    Water A o c e n to tfi* Port of Pohang, Korwa

    . HUM Burgener&Bi gfoo t. com.

    140 II.

  • AutoCAD RECTANG (). - . Rectangle () - Draw ().

    AutoCAD . - . , , 6 3 , @ , 3.

    f , , - * , .

    .!

    .

    Specify other corner point or [Dimensions]: DimensionSpecify length for rectangles : Specify width for rectangles : Specify other corner point or [Dimensions]: , -

    - , . 6.2. - - . , , .

    . 6.2. , ,

    - . Dimensions - .

    . 141

  • RECTANG . , , , - . 10, " ". width() ( 16)\ , RECTANG Elevat ion () Thickness (). - 21, " ". - XY. RECTANG , .. AutoCAD, - ( , - LINE). 16, " ".

    AutoCAD , POLYGON(), . AutoCAD 3 1 024. , Polygon() Draw ().

    , , . 6.1.

    Edge ()

    Inscribed incircle()

    Circumscribedabout circle( )

    , , Edge ()

  • ( ), - . , . , , . , , .

    , AutoCAD ( , , 0). 8, " ", , .

    POLYGON , , .

    (') (") . , - (") , , , . , , .

    -a.dwg, - Drawings -.

    . 1. -. dwg -.

    2. AutoCAD B i b l e ab6-2 .dwg. -, - SNAP () GRID () . , 1 . , OSNAP.

    3. Rectangle Draw.

    ~*" 4, Specify f i r s t c o r n e r p o i n t or[ C h a m f e r / E l e v a t i o n / F i l l e t / T h i c k n e s s / W i d t h ] : ( - [/ / / / ]:) "," . Specifyo t h e r c o r n e r p o i n t : ( :) @2'1",1'9"

  • 7. RepeatRectangle ( ), , RECTANG. 7",2'6" . . Speci f o t h e r c o r n e rp o i n t : @",2"$.

    8. RECTANG. 2'0",2'7" . Speci fy o t h e r c o r n e r p o i n t : @l,S

  • , -

    . -, .

    , .

    .

    .

    , - .

    , , , .

    , LINE, AutoCAD x l i n e , , , .. . , .

    , . - , , , . , . , , - . - .

    ZOOM E x t e n t s ( ) AutoCAD "" ( x l i n e ) , . - 8, " ".

    . , , - IV, " ".

    AutoCAD - XLINE ().

    Construction Line ( ) Draw. , AutoCAD : Speci fy a p o i n t or[Hor/Ver/Ang/Bisect/Of f s e t ] : ( [////]:).

    , , AutoCAD -, . LINE. . 6.2.

    6. 145

  • S p e c i f y . -p o i n t AutoCAD , .( ) . S p e c i f y through

    p o i n t : (, :)

    () h

  • -b.dwg, - Drawings -.

    .

    1. -b.dwg -. - , - 4, " ". .

    2. AutoCAD B i b l e ab6-3.dwg.

    3. Construction Line Draw.

    " 4. Speci fy a p o i n t or [ H o r / V e r / A n g / B i s e c t / O f f s e t j : 1, . 6.4.

    . 6.4. :

    5. Specify through p o i n t : 2.

    6. . : , - , . . , - 11, " , , ".

    7. AutoCAD Draw=*Ray.

    8. Specify s t a r t p o i n t : 3, . 6.4.

    9. Specify through p o i n t : 4.

    10. .

    -

    AutoCAD , , , - .

    -, , .

    6. 147

  • . s

    -rt*

    = 8 .!

    utoCAD -

    , , . , , . , , .

    -. , - ,, . 16, " ".

    -

    I _!!.

    -

    ., - . , - . .

    CIRCLEpi AutoCAD LW - CIRCLE (). Circle () Draw (). - Spec i fy c e n t e r p o i n t for c i r c l e or[3F/2P/Ttr {tan t a n r a d i u s ) ] : ( [/2/ ( -)]:). - . 7.1.

  • 7 . 1 . C I R C L E

    Center Radius(, )

    Center Diameter

    (, )

    2(2)

    ()

    Tangent, Tangent,Radius (,, )

    . , . - , ,

    , dtff,

    2 points (2 ). 2

  • 3. Circle Draw. 2
  • 8, . 7.1. Specify secondp o i n t on c i r c l e : 9. Specify t h i r d p o i n t on c i r c l e : ( :) Midpoint () 10.

    8. -. , , .

    9. CIRCLE. Speci fy c e n t e r p o i n t for c i r c l e or [3P/2P/Ttr {tant a n r a d i u s ) ] : Center () - , 7. Speci fy r a d i u s of c i r c l e or[Diameter] : .05

  • , , , - , . , 9, ": ".

    . , ,

    , , , "". AutoCAD . , , , , .

    ARC (). ,

    , AutoCAD , , . . 7.3 , - , .

    . 7.3. , -

    . 7.4 AutoCAD. ARC , - S t a r t p o i n t ( ) C e n t e r (). , -, .

    . , , .

    | ARC Arc () s i l l Draw, , . , .

    152 U.

  • Center ()

    Start point( ) End ()

    Angle ( )Length of chord ( )Endpoint ( )

    Angle ( )Direction ()Radius ()Center point ( )

    Arc () Second point( ) Endpoint ( )

    Center () Start ()Angle ( )Length of chord ( )Endpoint ( )

    . 7.4.

    , , : , , . AutoCAD , - , .. , , . , , .

    - , . AutoCAD -, .

    , - . 7.5.

    ab7-b.dwg, - Drawings -.

    . 1. ab7-b. dwg -.

    2. AutoCAD B i b l e ab7-2.dwg. - . Fractional( ). I n t e r s e c t i o n (), C e n t e r () Endpoint (). , Tools^Drafting Settings (1*) OSNAP - Settings (). - .

    7. 153

  • . 7,5. . - (Jerry Bottenfield) Clow Valve Company, (. )

    3. LINE () 2,3. (Direct Distance Entry) 7 . LINE.

    , , 4, " ".

    4. 2-3/4 , , 5-1/2,1-5/8. . - ( ) -, .

    , 11, " , , ":

    154

    5. 11/16 . I n t e r s e c t i o n .

    6. 1 Center .

    7. . ( , ) - From (). , - Center, -

    II.

  • @-1-15/16,0. , 1-15/16 . 3/8 .

    8. . From . - @1-15/1,0. , 1-15/16 . 3/8 .

    9. Arc Draw :Specify s t a r t p o i n t of a rc or [CEnter] : From Base p o i n t : , - Center : 8-5/8,0

  • 14. ARC :Specify s ta r t point of arc or [CEnter] : ., . - Endpoint Specify second point of arc or [CEnter/ENd]: EndSpecify end point of a r c : From _from Base p o i n t : Center : @5/8,0
  • , AutoCAD ,

    . . , - , - ( , ). R o t a t i o n () 90, . , AutoCAD, 89.4. 0, , . , - 89.4. 45 - .

    , , ( , ). - - ( , ) , . - .

    , , Arc

    (). - ( , , ). - AutoCAD S p e c i f y s t a r t a n g l e or[ P a r a m e t e r ] : ( []:). - , .

    S t a r t angle ( ). . - , ( , , ). AutoCAD ; Specify end ang le or[ P a r a m e t e r / I n c l u d e d a n g l e ] : ( [/ -

    ]:).

    End angle ( ). - .

    I n c l u d e d ang le ( ). , , , - .

    P a r a m e t e r (). , , - . AutoCAD : S p e c i f y s t a r t p a r a m e t e r or[Angle] : ( []:), S p e c i f y end

    p a r a m e t e r or [ A n g l e / I n c l u d e d a n g l e ] : ( - [/ ]:). - , . , - , - .

    7. 157

  • AutoCAD ELLIPSE (), Ellipse () Draw. , AutoCAD , , . . - . , .

    ? Ellipse Arc ( ) - - * . ELLIPSE

    - / -* Arc.!

    &* ^ "" AutoCAD: . - , ,

    - .

    ab7-c.dwg, - Drawings -.

    . 1. ab7-c. dwg -.

    2. AutoCAD Bible ab7-3 .dwg. - ( SNAP () OSNAP () ). Endpoint. 6 . , -, ( ) -.

    M S 3. Ellipse Draw. Specifyi s ! a x i s e n d p o i n t of e l l i p s e or [Arc/Center] : (

    [/]:) - Center () . S p e c i f y c e n t e rof e l l i p s e : ( ). 8',10', - . S p e c i f ye n d p o i n t of a x i s : ( :). , 3 '

  • 4. Ellipse Arc Draw :Specify axis endpoint of e l l i p t i c a l arc or [Center]: - Center S p e c i f y c e n t e r of e l l i p t i c a l a r c : 8',3' - Specify endpoint of ax is : , 1'
  • , .) - - .

    9. . , . 7.8.

    . 7.8. - -,

    0

    ?

    AutoCAD ,

    , .. , , . , , , DONUT DOUGHNUT(). , - . . 0, .

    FILLMODE, - FILL (). , AutoCAD . fill

  • . , AutoCAD

    . , , ,, -, .

    DONUT AutoCAD DONUT .

    Specify i n s i d e diameter of donut : ( :). . .

    Specify o u t s i d e d iameter of donut < 1 . 0000>: ( :). . .

    Specify second p o i n t : ( :). , AutoCAD . .

    Specify c e n t e r of doughnut: ( :). -. .

    AutoCAD . AutoCAD

    Draw^Donut (1^1 ). - , . AutoCAD , , , . , .

    . 16. " ". -

    DONUT , -\ . -

    .

    . .

    . point () . , -

    , . , . . . - - From () Tracking (). , , , .

    7. 161

  • D I V I D E ( ) M E A S U R E ( ) p o i n t () . 12, \ " ".

    . - AutoCAD 20 - , -. , , . .

    AutoCAD FormatoPoint Style(1^ ), PointStyle ( ), . 7.10.

    , , . Point Size ( ), - . . 7,10.

    Point Style Set Size Relative to Screen ( ).

    - , . , - . - . - 5% .

    Set Size in Absolute Units ( ), , , , . - . , .

    .

    . ( AutoCAD 2000) .

    - . POINT () Point () - Draw. AutoCAD :

    Current po int modes: PDMODE=34 PDSIZE=0.0000Specify a p o i n t :

    162 It.

  • PDMODE . PDSIZE . 0, -. : , . AutoCAD - , . .

    AutoCAD -. - .

    BLIPMODE , , - REDRAW ().

    , (.. ), , -

    Point Style ( ). , , .

    ab7-d.dwg, - Drawings -.

    . 1. ab7-d. dwg -.

    2. AutoCAD B i b l e ab7-4 .dwg. -. - ( OSNAP () ""). Quadrant (), Center (),Endpoint () Node ().

    3. AutoCAD FormatoPoint Style. Point Style. 3 . SetSize Relative to Screen ( ). Point Size - 5.0000%, .

    4. Point Draw. - :Specify a p o i n t : From . , - Base p o i n t : , Endpoint < O f f s e t > : @.8,-.9^

    AutoCAD .

    5. AutoCAD Draw=>Donut (^ ). - :

    7. 163

  • Specify inside diameter of donut : 04
  • r-^i

    t * i

    , , - ,

    - - , . - ZOOM() . - AutoCAD . - - .

    AutoCAD

    , AutoCAD, - .

    AutoCAD . , - -, - . AutoCAD. . ,AutoCAD - . -

    IVtev

    ;*^:Tsri

    Vjepi

    '

  • - , , AutoCAD . . , Regenarating model ( ).

    , , - (, ). , - , . , - , AutoCAD .

    , , , . - AutoCAD , . , -, AutoCAD . .

    REGEN REDRAW REDRAW () Auto-

    CAD, , "" - (blips) . , . REDRAWALL () .

    REGEN () , - . , REGEN, - . , AutoCAD , regen REGEN, - (.. regen regeneration , regenerate). REGENALL () . regen . , . - View^Redraw.

    AutoCAD -, . - .

    , , -

    . , , , . - AutoCAD PAN (). - , , "" .

    166 II.

  • PAN PAN -

    . AutoCAD (real-

    time panning). ., .

    | , , 1 Pan Realtime ( ) -. . , - -. . , - . , . "" , .

    , , . - . - (. 8.1). PAN , , .

    . 8.1.

    - . - ZOOM ().

    ^00^ AutoCAD ^ Microsoft IntelliMouse. , -

    , . , Pan Realtime -. .

    , - 13 . AutoCAD View^Pan =>Point(=>1*). Disp lacement : (:) . Second p o i n t : ( :). , . - , , .

    , Windows. , - AutoCAD, , . AutoCAD PAN.

    , .

    8. 167

  • .

    , .

    .

    ab8-a.dwg, - Drawings -.

    . 1. ab8-a.dwg - (

    , 7, " ")- , . -, . 8.2.

    . 8.2. ^

    2. Pan Realtime . 1, . 8.2, , - , 2. , - , , , , 2. .

    3. . . .

    4. . .

    5. PAN. ( ) . - .

  • . 8.3.

    ZOOM ZOOM () .

    , , - - . - . , . ZOOM - , , .

    , ZOOM, . - , . ZOOM , , . 9, ": ".

    2 , , . Zoom Realtime ( ) -. , " + " (), "*' (). , - . - . , , , . " + " , - . , , . 100% (). - 100% .

    . - , . , , . .

    8. 169

  • AutoCAD Microsoft IntelliMouse. - ., AutoCAD ., , .

    ZOOM Zoom () . ,

    Zoom Previous ( ). ZOOM . 8-1.

    window () , -. AutoCAD . wi n do w .

    : AutoCAD , , ,

    Dynamic -() .

    S c a l e -() , -

    , , . , - , - . , , ( 17). 1 (, .5) , 1

    C e n t e r () , . -. . -, ,

    i n () s c a l e 2

    Out () s c a l e . 5

    A l l () ,

    170 II.

  • . 8.1

    | Extents , -^ ^ ()

    Previous -^* () . -

    Dynamic ZOOM Dynamic ZOOM , -

    . A e r i a l View ( ), - ( ). -, Dynamic.

    Zoom Dynamic , - . - . , - . - . -. , - - . - . . .

    . , - .

    . , - . , . , , . , , - .

    , - . AutoCAD - . . 8.4 . - .

    ab8-b.dwg, - Drawings -.

    8. 171

  • \

    L

    . 8.4. AutoCAD ZOOM Dynamic

    . ZOOM1. ab8-b.dwg -. , -

    . 8.5.

    172

    . 8.5. .: (Bryan Kelly), ATI Corpo-ration, (. )

    2. , , Zoom Window () Zoom ().

    3. Specify f i r s t c o r n e r : ( :) - 1, . 8.5. Speci fyo p p o s i t e c o r n e r : ( :) 2. Auto-CAD , , . 8.6.

    II.

  • . 8.6. - ZOOM Window

    4. Zoom All () Zoom.

    5. Zoom Previous () -. AutoCAD . 6. Zoom Extents () Zoom. . -

    , , , - , ZOOM Al l ZOOME x t e n t s .

    7. Zoom Center () Zoom. Specify c e n t e r p o i n t : 3, . 8.5. Enter m a g n i f i c a t i o n or h e i g h t: ( :) 500

  • : i

    |

    L_::.:-_::.zj

    . 8.7. ZOOM Dynamic

    Left () Vmax () , - AutoCAD ZOOM . , - , , .

    Aerial View

    Zoom In ()

    Zoom Out ()

    Global ()

    4-Aeti.il View :\/ Bible1....

    AutoCAD, A e r i a l View ( ), ZOOM Dynamic. -, . - , Aerial View ( )

    , . , -

    Aerial View (. 8.8), AutoCADView=>Aerial View (^ ).

    , AerialView . , ( ), , - , - . , , , , . -, Aerial View, Aerial View , - Close () . Aerial View . -

    . 8,8. Aerial View .

    174 II.

  • Aerial View . , , - .

    1. Aerial View, . Aerial View , - . , , ZOOM Dynamic. .

    2. . - AutoCAD. - , - .

    3. . . , . Aerial View - , , -, , .

    4. , . , - , .

    5. , . .

    Aerial View - . - Zoom Out () Zoom In () - . , Global (). AutoCAD.

    Aerial View , Zoom Out -. Zoom In, - Aerial View.

    , , . Aerial View OptionsORealtime Zoom (1^ ). , - . Aerial View, ,

    Aerial View Options Aerial View , -

    . Auto Viewport () -

    8. 175

  • , ( ) . . Auto Viewport , Aerial View , , . - Aerial View.

    Dynamic Update , Aerial View - , . , , - , , - . , - AutoCAD , AerialView, Dynamic Update.

    , Aerial View .

    Aerial View Aerial View , -

    . - Aerial View . - AutoCAD.

    , Aerial View - , . AutoCAD, .

    Aerial View (.. ), Close .

    ab8-b.dwg, - Drawings -.

    . Aerial View1. ab8-b. dwg -, -

    .

    2. AutoCAD View^Aerial View (^ ). - Aerial View ( ). .

    3. Aerial View, . : , , - ( ) - ( , - , Zoom Center).

    4. , Aerial View. . , - . - . . AutoCAD -

    176 //.

  • . Aerial View - , ( ). . 8.9; .

    O F F I C E

    X . '

    Xlaw Qpdoni. [

    i | |

    1

    . 8.9. ,

    5. Aerial View, . AutoCAD - .

    6. Aerial View. . 4 , . , - ( ). - . , . 8.10.

    Option Hwlp

    .

    Battery Chargers

    . 8.10. ,

    8. 177

  • 7. Aerial View , . AutoCAD .

    8. . Aerial View. , .

    ,

    , , , , . AutoCAD .

    , - . ZOOM PAN , - . , , - .

    6 , , . ,

    . - . -

    , .

    , . , AutoCAD, ZOOM PAN, Aerial View. View () . Named Views ( ), . DDVIEW (), View(), . 8.11. , AutoCAD View^Named Views (^ ).

    , CURRENT (), , .. AutoCAD. New (), New View ( ) . 8.12. View name( ) .

    AutoCAD 255 , - . -, .

    View (), - . AutoCAD.

    New View ( ) - .

    II.

  • _-dr 1 " - \*W" " 1 :iM^!ili.'

    . 8.11. View

    /'. 3./Z New View

    1. Named Views ( ) - View () View.

    2. New () - New View.

    3. View name .

    4. Define Window ( ).

    5. Define View Window ( ). AutoCAD - .

    6. Speci f f i r s t c o r n e r : ( :) .

    7. Speci fy o p p o s i t e c o r n e r : ( :) . AutoCAD New View.

    8. . AutoCAD View.

    9. , . 2-8, , .

    8. 179

  • , ,

    . - View ().

    1. View, NamedViews View.

    2. , - .

    3. Set Current ( ).

    4. .

    AutoCAD, View,

    , , . , , View, - , , . - .

    , View - Details (). View Details ( ), , , , .

    ab8-b.dwg, - Drawings -.

    . 1. ab8-b. dwg -,

    .

    2. a b 8 - l . dwg AutoCAD Bible .

    3. Named Views View - * View,

    4. New , New View.

    5. View name top left ( ) .

    6. Define Window, DefineView Window. AutoCAD .

    7. Specify f i r s t c o r n e r : ( :) - , Speci fy o t h e r c o r n e r : ( :) - . AutoCAD - New View.

    8. .

    9. New. New View bottom left.

    180 II.

  • 10. Define Window ( ), Define View Window ( ). Specifyf i r s t c o r n e r : , Specify o t h e r c o r n e r : . New View, . : View , , (. 8.13).

    . 8.13. View -

    11. View.

    12. ZOOM E x t e n t s -. View, NamedViews. View BOTTOMLEFT Set Current ( ), .AutoCAD .

    13. . .

    . -, . -, , .

    ,

    . Open () . Select File ( ) Select Initial View ( ). Open (). Select InitialView ( ). .

    8. 181

  • AutoCAD -

    , . , . , - . . , - , . - .

    AutoCAD, .

    1. File^Open. AutoCAD Select File.

    2. Partial Open ( -). ( Partial Open , - .) AutoCAD Partial Open (. 8.14).

    View gwmby to toad

    Lew Name11120COLUMNSFIXrilflESFLOWBACXSHLViNGSTRUCT

    I LoadGaomebvj

    F

    . 8.14. Partial Open

    3. .

    4. . Load All( ). ( , . 11, " , -, ".) Open ().

    , , - . File^Partial Load( ^ ). ( , - .) AutoCAD Partial Open( ). - , . , , * E x t e n t s * . . Pick a Win-dow ( ) . , , Load All( ).. , , . .

    182 II.

  • (tiled viewports)

    AutoCAD . - . . , - , . : , .

    AutoCAD (tiled) - (floating). . - , 17, " ".

    AutoCAD - , . . AutoCAD .

    .

    , , - . - AutoCAD, .

    - .

    .

    ( ) - (, ).

    , - , (, , , ).

    AutoCAD 96 (, ). - .

    , - . , , - , .

    , - AutoCAD.

    . 8.15 AutoCAD, , .

    , ,

    . AutoCAD .

    8. 183

  • -!S...

    ;

    lit

    . 5.75. , . : (JerryBattenjield), Clow Valve Company, (. )

    , -, , , . ? - . .

    , , -

    View^>Viewports (^ ). , (. 8.16).

    - , - - . , - 2 Viewports (2 ), Enter a c o n f i g u r a t i o n o p t i o n[ H o r i z o n t a l / V e r t i c a l ] < V e r t i c a l > : ( - [/] :). Horizontal(), - , Vertical(), . 4 Viewports (4 ), Auto-

    CAD , . , 3 Viewports (3 ), . : .

    , . New Viewports ( ) Viewports (), New Viewports ( ),

    Bamtd Viewports...Nfiw Vtawporfe...1 Viewport " .,JV'i1 i3V - - -

    IV - *I ' .- l

    f t

    Puc. 8.16.

    184 II.

  • . 8.17. - , AutoCAD .

    , , - . Pre-view Change view ( ) , . , Setup () 3D, AutoCAD - . , .

    New Viewport* ]

    r;fc;

    Srtfe1*:: VencThtee:LettThree: AboveThree: BelowThree: VerticalThree: HweailalFour EqualFour: FlightFour: Lelt "Curent"

    ~3 j wuii

    Croel *

    . 8.17. New Viewports Viewports - -

    New Viewports Viewports . , - .

    Apply to ( ) - . 8.17. , AutoCAD. - ( ). , . , - . View^Viewports^New Viewports (1^ -^ ), Apply to ( ) Current Viewport () .

    , AutoCAD - , . New Viewports Viewports Standard viewports Four: Equal (: ), Apply to Current Viewport( ), , .

    8. 185

  • : -

    . - : AutoCAD View6*Viewports^*Join (^ '*). S e l e c t dominant v iewport< c u r r e n t v iewpor t>: ( :) , "" , , - . S e l e c t v iewport toj o i n : ( :). , . , - .

    AutoCAD View1^Viewports1^ 1 Viewport ('=> 1 ). AutoCAD , -, .

    , -

    , "". , .

    .

    1. (); - .

    2. ZOOM PAN, .

    AutoCAD ,

    j , . .

    ,

    . - -, . , , , , . , , . ?

    1. , - . , .

    186 //.

  • 2. .

    3. ( - ) , . .

    4. , , : . - , - .

    -. 9,": ", 10, " - ".

    , . .

    , . , .

    -

    .

    1. ViewViewports New Viewports ( ^ ^ ), New Viewports () Viewports.

    2. New name ( ) .

    255 , .

    - , , - (, ).

    1. View-Viewports1^Named Viewports (=*^ ). AutoCAD Named Viewports( ) Viewports (. 8.18).

    2. , -.

    3. .

    8, 187

  • I 41 Viewports

    _* j *' |

    . 8.18. Named Viewports Viewports

    AutoCAD , . 17, " - ", . - - . ( , ).

    , - , . , . - , , , -. . . - , , AutoCAD .

    , , - , -. 17, " ". , ,, .

    ab8-c.dwg, - Drawings -.

    188 II.

  • . ,

    1. ab8-c . dwg -.

    2. ab8-2 . dwg AutoCAD B i b l e .

    3. View^Viewports^New Viewports NewViewports Viewports.

    4. Three:Above (: ). - . AutoCAD .

    5. . ZoomWindow ( ) Zoom () .

    6. . ZoomWindow ( ) Zoom () , , .

    7. . Zoom Ex-tents ( ) Zoom (). . 8.19 .

    . 8.19.

    8. View^Viewports^New Viewports. New name 3view Ring .

    9. , , View=>Viewports^ Viewport ( ^1 ). AutoCAD , , .

    10. View^Viewports1^Named Viewports. AutoCAD Named Viewports Viewports.

    . 3 view Ring . AutoCAD - , : ~ . .

    12. .

    8. 189

  • -

    , , . , - , .

    (. 8.20).

    . 8.20. , - , . (Robert Mack) Dexter Company, (. )

    . AutoCAD :

    , -;

    , ;

    ();

    () , .

    , . .

    , - . , - . - (Direct Distance Entry). , , , .

    , . AutoCAD Tools^Drafting Settings (1^

    190 II.

  • ); Drafting Sett ings ( -). , S N A P Sett ings (). S n a p () Angle ( ),

    , , . - , 0,0 . - , . X B a s e ( X) YB a s e ( Y). , .

    , ID (). 12, " ".

    Drafting Settings () AutoCAD. - (, , ). . 8.21 , 45. : 100%. - .

    . 8.21. 45". . -

    , , , ,

    .

    8. 191

  • , , , (). - , - . , - , - .

    AutoCAD -

    , , {World Coordinate System). AutoCAD . - AutoCAD : X , Y - . X( (East)). , W( ), . 8.22.

    . 8.22. W,

    - () . - , .

    , , - . , - , 0,0. AutoCAD - .

    AutoCAD Tools^New UCS (1^

    ). , , . 8.2. UCS ().

    8.2. '- ".._.;

    World () X , Y

    Object () . XY , , - ( , - ..), , X, - ( ..). - ( ), ; , X XY

    192 //.

  • , .2

    Face () View () ,

    Origin , -() , , Z axis Vector (Z ) Z . -

    3 Point ( (3 ) , X, -

    Y; X). Z X Y

    X X. .

    Y. .

    Z Z. .

    ToolS^Move UCS { => ) , . Origin (). , Z ( AutoCAD Z depth Z).

    Tools Orthographic UCS (* ) - , - . -, 21, " ".

    , - ( ) - . .

    1. , .

    2. AutoCAD Tools^Named UCS (^). AutoCAD UCS (), - Named UCSs ( ) . 8.23. , Unnamed -. , -

    8. 193

  • . , .

    Onert UCS. arc bateWald Previous

    I- \ ..'

    . 8.23. Named UCSs UCS

    3. Unnamed . . . 255 .

    4. .

    Tools^Named UCS( ). Display UCS Dialog ( ) UCS (). ( "" .) Set Current { ). , - .

    , UCS Previous ( ) UCS (). - Named UCSs - UCS, .

    Named UCSs .

    . -

    , - .

    . - , . - , , . .

    194 II.

  • , -, . AutoCAD (+) , . "" ( , ), AutoCAD - , (+).

    View1^ DisplaysUCS (^1^). Tools^New UCS (^ ), . - :

    Icon () / ;

    Icon Origin () / .

    AutoCAD 2000, - . ,

    ,..--* - , .- !

    , , - View^Display^UCS Icon Proper t ie s ( 1^ 1^ ^) ucsicon P r o p e r t i e s . , . 8.24. , , .

    103]UCS Icon

    . 8.24. UCS icon -

    (2D () 3D ()). Z, (.. - ), . (), X Y . Z , . - , , , .

    . ., , , Model - , . , , Close ().

    8. 195

  • , ,

    . , , ( ), - . 8.20 8.21.

    ab8-d.dwg, - Drawings -.

    .

    1. ab8-d.dwg -.

    2. AutoCAD Bible ab8-3. dwg. - - ("" ORTHO OSNAP ). Endpoint ().

    3. AutoCAD Tools^New UCS^Z Axis Rotate(=> IICK^Z ). -, 3 P o i n t (3 ) Object () , .

    4. Specify r o t a t i o n a n g l e about Z a x i s : ( Z :) 45

  • : 45 - , , . 90 , 135". - . , 90Specify next point or [Undo]: 180 , 3-9/64
  • 8. LINE. Specify f i r s tp o i n t : From. Basep o i n t : 1, - . 8.26. : @l/16,0
  • \

    . 8,27.

    , , - . , . - , - .

    - . , - 100%, - . Display () Options(), Tools Options ( ).

    AutoCAD Tools^Drafting Set-

    tings (1^ ). Snap and Grid ( ) Snap Type & Style ( ) Grid snap( ) Isometric snap ( ). , . . , - .

    , . - . - ELLIPSE () I s o c i r c l e ().

    . 1. Start from Scratch.

    2. AutoCAD Bib le ab8-4 . dwg.

    3. SNAP Settings (). - Drafting Settings ( ), - Snap and Grid ( ). Snap Type & Style (

    8. 199

  • ) Grid snap ( ) Isometric snap ( ).

    4. Snap () Y Spacing ( Y) Y .5. Grid (). AutoCAD.

    5. Tools Options (1^ ) Display () Options (). - Crosshair size ( ) 100. .

    6. , < I s o p l a n e Left>() .

    7. LINE. Specify f i r s t p o i n t : 3.4 641,2 . . Speci fy next p o i n tor [Undo] : 6 .4952,0.2 5. ( , - .) , Specify next p o i n t or [Close/Undo] : 6.4952,1.25, 3 . 4 6 4 1 , 3 . S p e c i f y nextp o i n t or [Close/Undo] : : AutoCAD . Close (). . - , . , . 8.28.

    200

    . 8.28. -

    8. . < I s o p l a n e Right> ().

    9. LINE. Specify f i r s t p o i n t : - 6.4952,1.2 5, - . . Specify next p o i n t or[Undo] : , 2 . 000

  • 10. . (). LINE 8.2272,2.25 . - 3.500
  • , . .

    , -, - . - .

    , - .

    .

    202 II.

  • :

    " " -. -

    . - , -, -. , , , . -, , .

    . , -, , . , .

    , ,

    AutoCAD . - - . , .

    Modify (), . :

    , , - ;

    [; ..;:,

  • , , .

    .

    .

    . (

    ) ( ). .

    , , Auio-CAD S e l e c t o b j e c t s : ( :). - AutoCAD , , (. 9.1).

    AutoCAD S e l e c t o b j e c t s : , , . - , - .

    , , , (. 9.2). .

    , , - .

    9

    6

    6

    . 9.1.

    >

    . 9.2. . -

    | | . ERASE,.-.,.1 () . , Erase () Modify (). Erase () .

    204 II.

  • ab9-a.dwg, - Drawings -.

    . 1. ab9-a. dwg -.

    2. a b 9 - l . dwg AutoCAD Bib le . (. 9.3).

    3. 1 . 9.3 , , . "", .

    4. Erase Modify. AutoCAD .

    -CONCRETE FILLEDGALVANIZED STEEL PIPES

    100 GALLONCONDENSATE

    1/4" THREADED GASSAMPLING PORT

    PRESSURE: GAGE

    GATE VALVE

    1" HDPE DRIPLEC

    GAS EXTRACTION WELL PLANN.T.S.. 9.3. . -

    - (U.S. Aimy Corps of Engineers). - Web- :http://cadlib.wes.army.mil

    5. Repeat Erase () .

    6. S e l e c t o b j e c t s : 2 (. . 9.3).

    9. : 205

  • 7. AutoCAD 1 found (1 ) S e l e c t o b j e c t s : . .AutoCAD .

    8. .

    OOPS () , . - OOPS 18, " ",

    MOVE (). -

    , , .

    EL'"" Move () -U^LJ. Modify. : Move, . AutoCAD : Specify basep o i n t or d i s p l a c e m e n t : ( :).

    AutoCAD.

    : , - , , - (, 2,3 2

  • . , , Drafting Settings ( ) . . 0, AutoCAD Snap X Spacing ( X). - ( / ). - ( , ). - "" . - , - . , .

    " ", , -. .

    1. .

    2. , . - . .

    3. "" , . , . AutoCAD , .

    4. .

    AutoCAD / Windows. , . Cut(). , Paste (). AutoCAD , , - . , -, AutoCAD - , MOVE.

    ab9-b.dwg, - Drawings -.

    . 1. a b 9 - b . dwg -.

    2. a b 9 - 2 .dwg AutoCAD B i b l e . - . -, . ( - 18, " ".) - OSNAP . Intersection (;).

    9. : 207

  • 3. , . - . Move () Modify (). AutoCAD:Specify base point or displacement: - 1, . 9.4, Specify second point of displacement or
  • . ,

    AutoCAD , -, .

    . Copy Object4 ( ) Modify. : - , .

    COPY () M u l t i p l e (), - .

    COPY AutoCAD : Specify basep o i n t or d i s p l a c e m e n t , or [Mul t ip le ] : ( -, []:).

    , , AutoCAD.

    : , - , , (, 2,3 2

  • OSNAP . - Endpoint ().

    3. , . 9.5(1), ZOOM Window ( ). 24- .

    UPPER SPARKELECTRODE

    LOWER IGNITIONCONTROLLER

    . 9.5. . (Robert Mack), Dex-ter Company, (. )

    4. - ( ). 1, - . 9.6. Copy Object ( ) - Modify. AutoCAD:

    Specify base point or displacement, or [Multiple]: m

  • . 9.6.

    5. ZOOM Previous( ).

    6. 2, . 9,5 ( - ). , , . , .

    7. Copy Object Modify. 2 (. . 9.5). . .

    8. , 3, . 9.5. . AutoCAD S e l e c t o b j e c t s : .

    9. AutoCAD Specify base p o i n t or d i s p l a c e m e n t ,or [Mult ip le] : 4, . AutoCAD Speci f second p o i n t of d i s p l a c e m e n tor

  • . ( .)

    - Windows " ". AutoCAD . AutoCAD Windows Tile Vertically (^ ). - (), , . , - , - AutoCAD .

    Copy w i t h Base p o i n t ( ). .

    1. (), .

    2. Copy with Base Point( ) .

    3. S p e c i f y b a s e p o i n t : . -. AutoCAD () , - .

    4. .

    5. Paste () - ( Paste ). AutoCAD . - , - .. AutoCAD - , .

    , -, . 5 Paste to Original Coordinates( ). AutoCAD , . , - .

    AutoCAD - , . .

    AutoCAD Windows, Word. AutoCAD 27, " ".

    - .

    ab9-c.dwg, - Drawings -.

    212 II.

  • . 1. . ab9-c.dwg -

    . ab9-4 . dwg AutoCAD B i b l e . Open () 9 -3 . dwg, AutoCAD B i b l e . - , R e s u l t s -.

    2. Window^ Tile Vertically. AutoCAD, - (. 9.7).

    In-results 1)93. dwg Heart Only

    . 9.7. , AutoCAD

    3. a b 9 - 3 . dwg, , OSNAP . - Endpoint.

    4. 1 .

    5. . Copy with B a s e Point ( ) .

    6. S p e c i f y b a s e p o i n t :

    2, . 9.7.

    7. ab9-4 . dwg. Paste . S p e c i f yi n s e r t i o n p o i n t : 3, . 9.7. AutoCAD .

    8. - ab9-3.dwg. 4. . -, , . , , - . 5. , - ~ - AutoCAD .

    9. : 213

  • 9. 9-3 . dwg. - 4. Copy withBase Point . Specify basep o i n t : .

    10. ab9-4.dwg. Paste to Original Coordinates ( ) - . AutoCAD (, ).

    11. 9-4 . dwg. 9-3 . dwg .

    AutoCAD ( ) -

    . . . 5, " ", - , , - . , . , .

    ESyi Rotate ^ () Modify. : Rotate .

    - AutoLISP- Mrotate. isp, - . \Software\Chap09\Mrotate.

    , . Reference () . - AutoCAD Specify t h e r e f e r e n c e a n g l e , , . - , . AutoCADSpecify the new a n g l e : . . Reference .

    ab7-3.dwg, - Drawings -.

    . 1. ab7-3.dwg R e s u l t s -. -

    7, " ", AutoCAD B i b l e .

    2. AutoCAD Bib le ab9-5 . dwg. - (. 9.8).

    214 II.

  • I U . . . .

    . 9.8. -

    3. GRID () .

    4. Tools^>Drafting Settings (1^ ). Object Snap ( ) Center (), Quadrant() Perpendicular (). . OSNAP .

    5. -. Rotate Modify.

    6. AutoCAD Specify base p o i n t : - , . - AutoCAD Specify r o t a t i o n ang le or [Reference] : 90

  • 10. ROTATE (). AutoCAD:

    S e l e c t o b j e c t s : , -, Specify base po int : , Center Specify rotation angle or [Reference]: 180

  • ). -, .. . - . AutoCAD - , 1. , 1. , , 2, . 1. - , 0.25, , .

    , ROTATE, - Reference. - , - . - , , . S p e c i f y new l e n g t h : , . Auto-CAD .

    Iffl Scale () - Modify . .

    ab9-d.dwg, - Drawings -.

    . 1. ab9-d. dwg, -.

    2. AutoCAD Bible ab9-6.dwg. (. 9.9) . . OSNAP . - Quadrant Endpoint.

    3. Scale Modify. S e l e c t o b j e c t s : ( , ) . . AutoCAD:

    Specify base p o i n t : Quadrant , Specify scale factor or [Reference]: - Reference Specify re ference length : Quadrant -, , Specify second p o i n t : Quadrant -, Specify new l e n g t h : 1

  • (). , - . , AutoCAD 1found. , - ZOOM Window. , , . AutoCAD:Specify base point : Endpoint 1 (. 9.9)/Reference: .4
  • , change . , .

    !

    CHANGE -, , . -, , . , - CHANGE -, , .

    , CHANGE ,

    . AutoCAD . , - , AutoCAD (. 9.11). - . AutoCAD (.. ), (. 9.11).

    . 9.11. CHANGE

    , CHANGE () -. , , . 9.12.

    . 9.12. CHANGE . - ,

    9. : 219

  • , AutoCAD . -

    , AutoCAD , -. . AutoCAD .

    AutoCAD - , . , - , .

    , Auto-CAD Change p o i n t i g n o r e d ( ). , ().

    ab9-e.dwg, - Drawings -.

    . 1. ab9-e . dwg -.

    2. AutoCAD Bib le ab9-7 .dwg. - , Endpoint P e r p e n d i c u l a r .

    3. ZOOM Window - .

    4. change^. AutoCAD S e l e c t o b j e c t s : . .

    5. AutoCAD Specify change p o i n t or[ P r o p e r t i e s ] : ( Enter ). Auto-CAD Specify new c i r c l e r a d i u s : ( ) 3/16

  • /1 -

    \ 3 /

    2

    / 4

    /. 9.13. - . - (U.S. Army Corps of Engineers). - Web- : ht fcp; //cadlib. wes. army .mil

    ]

    T R I M (). - 10," ".

    , , , -

    . , - ! ? AutoCAD - .

    (selection set) .

    AutoCAD S e l e c t

    o b j e c t s : . 16 , . , . - S e l e c t o b j e c t s : , , , - .

    , , S e l e c t o b j e c t s :. , AutoCAD .

    9. : 221

  • Window window () ,

    . , , . . 9.14 . . 9.15 .

    . 9.14. . AutoCAD , -

    . 9.15.

    Last Last () .

    222 .

  • Crossing C r o s s i n g () ,

    . , , - , . . 9.16 . . 9.17 .

    . 9.16. . AutoCAD , , -

    . 9.17.

    Box Box () Window C r o s s i n g .

    , AutoCAD window. C r o s s i n g . - , Box.

    9. : 223

  • All All () .

    Fence Fence ( )

    . AutoCAD , . . 9.18 , . 9.19 ( ).

    . 9.18.

    . 9.19.

    WPolygon WPolygon (Window Polygon)

    Window, , , . AutoCAD , - .

    224 II.

  • CPolygon CPolygon (Crossing Polygon) -

    Cross ing, , -, . AutoCAD , - .

    Group Group () . -

    10, " ".

    Add Add () Remove, -

    .

    Remove Remove () . -

    , , , (.. - , AutoCAD). - (.. , - ) Add.

    Remove -

    , .

    Multiple M u l t i p l e () ,

    . - .

    Previous Prev ious () , -

    . , , . - .

    Undo Undo () , -

    S e l e c t o b j e c t s : . , .. Remove, Undo .

    AUto AUto () -

    Box. , AUto.

    9. : 225

  • Single S i n g l e (), AutoCAD S e l e c t o b j e c t s : .

    , AutoCAD . , .

    AutoCAD, . ,

    R.G.Greer Design Inc.,

    R.G.Greer Design AutoCAD APDesign , AutoCAD (: 1-888-CADSOFT http://www.cadsoft.com) - . , . . ' - , -, ", (Rod Greer), R.G.Greer Design. , - AutoCAD , . , . . APDesign - , -, . AutoCAD APDesign APDesign. , , , , ( ) -, , . - . . - - Quancity, APDesign.

    . . , - ().

    226 .

  • , -

    , - . ? R.G.Greer Design . " - . , , ".

    , ( -

    ), . , , - , . , . S e l e c t o b j e c t s : -, , .AutoCAD ( ). . , , , - . AutoCAD . , . , .

    ,

    , . . , - Command: . , - , . , , , AutoCAD . S e l e c t ().

    SELECT . . AutoCAD Previous . S e l e c t o b j e c t s :

  • , -

    S e l e c t ob j e c t s :.

    AUto.

    . AutoCAD .

    . . AutoCAD , , , , .

    . . AutoCAD , , , -, .

    ab9-f .dwg, - Drawings -.

    . 1. ab9-f . dwg -.

    2. ab9-8 . dwg AutoCAD Bib le . - OSNAP . - Endpoint Perpendicular.

    3. . 9.20, 1 2. Last .

    4. select^.

    5. , 3. , - . 4 . .

    6. 1

  • . 9.20.

    . 9.21. , -

    10. , OSNAP -. MOVE. S e l e c t o b j e c t s :

  • AutoCAD .

    Tools=*Options ( ) Options () Selection (), . 9.22.

    . 9.22. Selection Options

    , AutoCAD -, . , , , , , . . , TRIM{) ( ) , , , - . F I L L E T () ( ) , , . , , , . - AutoCAD F I L L E T , -. AutoCAD , .

    , - , , .

    ARRAY ()

    DVIEW(flBHfl)

    MIRROR ()

    BLOCK ()

    ERASE ()

    MOVE()

    CHANGE ()

    EXPLODE ()

    ROTATE ()

    CHPROP ()

    HATCH ()

    STRETCH ()

    ()

    LIST ()

    WBLOCK ()

    230 ,

  • Noun/Verb Selection ,

    . , AutoCAD, noun ( ) , a verb () , - . .

    AutoCAD , . Windows, , () . , Microsoft Word , - .

    AutoCAD Noun/Verb Selection ( -/) Selection. - . , .

    , Windows, - . , AutoCAD - . , , - , "" .

    Use Shift to add Use Shift to add to selection ( Shift )

    Selection. . - AutoCAD . AutoCAD ; , - .

    Windows - . , - Windows. , . . - . Drawing () Microsoft Word . , , , . , , .

    AutoCAD , , , , - AutoCAD. , - , .

    Press and drag , -

    . , ZOOM Window. Press and drag ( ), , , . Windows.

    9. : 231

  • , , , .

    ZOOM window, .

    Implied windowing Implied windowing ( ) . -

    : , AutoCAD , . - . Implied windowing ( ) , AutoCAD , , 0 found (0 ).

    , S e l e c t o b j e c t s : . , C r o s s i n g Window ( w). - , .

    Object grouping . (

    .) Object grouping ( ) (AutoCAD ), . , - .

    Associative Hatch , () -

    . , . - Associative Hatch ( ) (AutoCAD ), , -. , , , (.. ). , -, . , , - , , .

    Pickbox Size 4, " ", , -

    . - ( ) , Pickbox Size ( ) - , .

    Noun/Verb Selection, , 15 ,

    i AutoCAD s e l e c t o b j e c t s : . , -/ Noun/Verb Selection, ,

    , .

    232 .

  • , . -. ERASE. - COPY MOVE. . .

    CHANGE ( ) - .

    . - , - .

    .

    9. : 233

  • ; ' )\\ ::

    s -:*Jfo: ' -

    * .*- V':

    . Obiect Property Manager-.. -. - .V-

    . t ..1?

    : .;.. .tffrt'.t

    - : - > ? :

    , , . - , -, , , - . - , AutoCAD 2000, ObjectProperty Manager. , : , Quick Select.

    - , - . MIRROR () - , - ; ARRAY() ; OFFSET () , , , -, COPY (). ALIGN () - .

  • MIRROR . ,

    , .

    ! , Mirror () Modify (). , - .

    AutoCAD . , .

    . , , ( -

    ORTHO () ) . .

    AutoCAD ( , - ). ,

  • . 10.1.

    6. AutoCAD D e l e t e s o u r c e o b j e c t s ? [Yes/No] :( ? [/] :), N (), .

    7. MIRROR, Mirror Modify. AutoCAD S e l e c t obj e c t s :

  • . 10.3 .

    r

    1

    !

    j

    . 10.3. . - , - . (Henry Dearborn) 1, (. )

    , .

    | | 1. Array () - Modify (). :

    Array Modify, . Array (), . 10.4.

    . 10.4. Array

    2. Rectangular Array ( ), , .

    10. 237

  • 3. , . , , Select Objects ( ). , .

    4. Rows () Columns () . , , - .

    5. () . - ( - ).

    6. () .

    7. , :

    [| 1~' 1

    8. , -. . , - Pick Angle of Array ( ).

    9. Preview( ).

    10. .

    ( 8, " - "), AutoCAD - .

    , , - COPY () , ,

    . ARRAY , COPY, .

    , -

    . . 10.5 , - () .

    .

    1. Array - Modify. : Array -

    Modify, Array.

    2. Polar Array ( ), , - .

    238 II.

  • . 10.5. , . (Robert Mack), Dexter Company, (. )

    3. , , - . , , Select Objects. , .

    4. , X Y - Pick Center Point ( ).

    , , - .

    5. Method () -, . - :

    Total Number of Items ( ) , , , .

    Angle to Fill ( ) , . , , - 180".

    Angle Between Items ( ) .

    6. . - .

    7. Rotate Items as Copied ( ), . -, AutoCAD .

    8. Preview( ).

    9. .

    , . AutoCAD, -

    10. 239

  • . . , AutoCAD , . , , . 10.1. , . , .

    , More () Object Base Point ( ). Set to Object's Default ( ) - , Pick BasePoint, , . , - , , -. , , , .

    IX

    ,

    , ( , ),,

    ( , ),

    (xline)

    -a.dwg, - Drawings -.

    . 1. -. dwg -.

    2. ablO-2.dwg AutoCAD Bible . , . 10.6. ONSNAP . - I n t e r s e c t i o n Center.

    3. Array. Array.

    '' 4. Select Objects . - 1, . 10.6, . .

    5. Rectangular Array, - .

    6. Rows 4, Columns 1.

    7. Row Offset 1. ( , - .)

    240 II.

  • V

    . 10.6.

    8. Preview. , . 10.7.

    . 10.7. -

    9. , , Array Modify.

    10. Array Select Objects. 2 (. . 10.6) .

    XI. Array 4 Rows, Columns 2.

    12. Pick Both Offsets. 2 3 (. . 10.6). ( - , 2. , .)

    13. Preview, , . , . 10.7, - .

    14. . 4, . 10.6.

    15. Array Modify.

    16. Array Polar Array.

    10. 241

  • 17. Pick Center Point, CenterPoint. 5 (. . 10.6).18. Method Total Number of Items and

    Angle to Fill. Total Number of Items 6, Angle to Fill 360.

    19. , , - . , . 10.7, .

    20. .

    21. . , . 10.7.

    OFFSET ()

    , ( ) - . - , ( - 16, " "). , : - ,

    . OFFSET , , - -

    / - , \ . . 10.8 . POLIGON(-), OFFSET.

    \ \ / /\ '-.._ / / . 10,8. OFFSET \ /

    , , Offset* () Modify. OFFSET .

    AutoCAD Speci fy o f f s e t d i s t a n c e or Through: ( :).

    AutoCAD - .

    , AutoCAD S e l e c t ob ject to o f f se t or : ( - :), . AutoCAD Specify p o i n t on s i d e to o f f s e t : ( -:) , -, AutoCAD S e l e c t ob jec t to o f f se t or : . , . .

    , (, ), t

  • o b j e c t to o f f s e t or < e x i t > : . . - Speci fy t h r o u g h p o i n t : (, :) -, . AutoCAD .

    abio-b.dwg, - Drawings -.

    . OFFSET1. -b. dwg -.

    2. -3 .dwg AutoCAD Bible . , - , . 10.9. OSNAP . Center .

    3. Offset Modify. - AutoCAD:

    Offset d i s t a n c e or Through : t

  • ALIGN ()

    . . , , (. 10.11).

    1-

    .

    2- I

    . 10.11.

    24, " ".

    , - , , . , - AutoCAD ^ Operations^Align (1* =>) , . : , Modify=>3D Operations'*Align. .

    1. AutoCAD . . , , .

    2. AutoCAD . -, .

    3. AutoCAD . ,AutoCAD . . , , .

    4. AutoCAD . , .

    5. AutoCAD . - . .

    244 //.

  • 6. AutoCAD S c a l e o b j e c t s based on a l i g n m e n tp o i n t s ? [Yes/No] : ( ?[/] :). , , AutoCAD . AutoCAD . , ( -), .
  • Specify t h i r d source po int or :
  • C-Sl

    - 3

    -

    ])-,

    7

    "]

    . 10.14.

    , , , . AutoCAD -

    ':. ., . -!1 Fence ( ). AutoCAD ,

    . Select c u t t i n g edges: ( :). AutoCAD , . - , .

    . 10.15.

    , , , , , . -, , , , , , , (xlines). - - , .

    10. 247

  • t'tM , Trim () \j"M Modify. TRIM . AutoCAD

    Current settings: Projection=UCS Edge=NoneSelect cutting edges ...Select objects:

    AutoCAD , . P r o j e c t i o n - . Edge . Edge Extend (), AutoCAD - . , . .

    , , TRIM, TO AutoCAD

    . s e l e c t c u t t i n g edges :

  • . 1. ablO-d.dwg -.

    2. -5 .dwg AutoCAD Bible . , - , . 10.16.

    . 10.16.

    3. Trim Modify. S e l e c t o b j e c t s : 1 2, . 10.16. .

    4. S e l e c t o b j e c t to t r i m or s h i f t - s e l e c t toextend or [Project/Edge/Undo] : 1 2. , . 10.16. AutoCAD . .

    5. Trim Modify. S e l e c t o b j e c t s : 3 4 . 10.16. .

    6. S e l e c t o b j e c t to t r i m or s h i f t - s e l e c t toe x t e n d or [Project/Edge/Undo] : - Edge () . AutoCAD Extend/No extend : . - Extend ().

    7. 5, 6 7 . 10.16. AutoCAD . , - .

    8. . , . 10.17.

    EXTEND () , TRIM,

    , - (. 10,18). TRIM, - , ( , ).

    10. 249

  • . 10.17.

    . 10.18. -

    , , - . AutoCAD , , . . - . 10.19.

    AutoCAD: , , , , , . - (xline). , .

    EXTEND -.-.. "' . -

    -'" ""'" .!

    , Extend () Modify. EXTEND - . AutoCAD :

    Current settings: Projection=UCS Edge=ExtendSelect boundary edges...Select objects:

    250 II.

  • -*

    .0(2)

    .005U90

    I V*

    1 t/2

    - > -

    V*

    ( *)

    1 1/2

    . 10.19.

    AutoCAD , . P r o j e c t i o n . Edge -. Edge Extend (), AutoCAD - . , . .

    , S e l e c t o b j e c t to extend or s h i f t -s e l e c t to t r i m or [Project/Edge/Undo] : ,

    10. 251

  • . , -, . . AutoCAD .

    , Edge. AutoCAD Extend/No extend :. - Extend . S e l e c tob ject to extend or s h i f t - s e l e c t to t r i m or [Project/Edge/Undo]: . , . - . AutoCAD .

    , Undo - .

    , . - . Fence.AutoCAD , .

    -e.dwg, - Drawings -.

    . 1. 0- . dwg -.

    2. 0 - 6 . dwg AutoCAD B i b l e . , - , . 10.20.

    . 10.20.

    3. Extend Modify. - S e l e c t o b j e c t s : 1, . 10.20. - .

    4. S e l e c t o b j e c t to e x t e n d or s h i f t - s e l e c t tot r i m or [Project/Edge/Undo] : 2 . 10,20. . AutoCAD .

    5. Extend Modify. S e l e c t o b j e c t s : 3 4 . 10.20. .

    252 II.

  • 6. S e l e c t o b j e c t to extend or s h i f t - s e l e c t tot r i m or [Project/Edge/Undo] : Edge () . AutoCAD Extend/Noextend :. Extend .

    7. 3 4. AutoCAD .

    8. . , , . 10.21.

    . 10.21.

    LENGTHEN () , . -

    , , , , . ( LENGTHEN , .) AutoCAD - . LENGTHEN - , TRIM EXTEND - , , 1".

    LENGTHEN . -, , Length of chord ( ) ARC ().

    | " >' ( ) , Lengthen () -L*L.-...;. Modify. LENGTHEN . AutoCAD S e l e c t an o b j e c t or[DElta/ Percent /Tota l /DYnamic] : ( [///

    ]:). .

    S e l e c t o b j e c t ( ). . . - . - - .

    DElta (). - . AutoCAD E n t e r d e l t a l e n g t h or [Angle]: ( [] :). - , Angle, -

    10. 253

  • , -. , , - . , .

    P e r c e n t (). Percent. Enter p e r c e n t a g e l e n g t h : -. 100 , 100 . .

    T o t a l (). Total. Specify t o t a l l e n g t h or [Angle] < 1 . 0000} >:( [] :) Angle (), , . , .

    DYnamic (). Dynamic. . .

    , AutoCAD - S e l e c t o b j e c t to change or [Undo] :. , . , , . AutoCAD , . , Undo. , .

    -f .dwg, - Drawings -.

    . 1. -f .dwg -.

    2. -7 .dwg AutoCAD Bib le . , - , . 10.22.

    [?!! 3. Lengthen Modify -& AutoCAD;

    Select an object or [DElta/Percent/Total/DYnamic]: - 1 . 10.22Current l e n g t h : 0.200Select an ob ject or [DElta/Percent/Total/DYnamic]: - DElta Enter d e l t a length or [Angle] : . 07

  • 1

    /

    . 10.22.

    5. Lengthen Modify - AutoCAD:

    Select an object or [DElta/Percent/Total/DYnamic]: - 2 . 10.22Current length: 0.407, included angle: 150Select an object or [DElta/Percent/Total/DYnamic]: - Total S p e c i f y t o t a l l e n g t h or [Angle] < 1 . 0 0 0 0 ) > : - Angle Specify t o t a l angle : 120

  • STRETCH (), , -

    . , - -. . , . . , , . , , . - -. . 10.24 .

    . 10.24.

    AutoCAD, , , . -, . - STRETCH . . - , CHANGE () - .

    |; , Stretch () -&& Modify. , STRETCH. .

    , AutoCAD S e l e c to b j e c t s t o s t r e t c h b y c r o s s i n g window o r c r o s s i n g p o l y g o n . . .( ...), S e l e c t o b j e c t s : ( :). - . - , AutoCAD S t r e t c h i n gs e l e c t e d o b j e c t s by l a s t w i n d o w . . . ( , - ...) .

    256 //.

  • , . - . , - , Remove () .
  • . 10.25.

    . 10.26.

    , -

    AutoCAD. BREAK () , -

    . CHAMFER () FILLET () - ,

    258 II.

  • ,

    , . BREAK . , AutoCAD , . . TRIM, , - 3REAK.

    AutoCAD: , , , (xlines), , , .

    , Break () - Modify. BREAK -

    . AutoCAD S e l e c t o b j e c t s : . (, .) .

    . AutoCAD Specify second break p o i n t or [ F i r s t p o i n t ] : ( [ ]:). , - . AutoCAD .

    , . , - AutoCAD S p e c i f y second b r e a k p o i n t or [ F i r s tp o i n t ] : ( [ ]:) - First point ( ). S p e c i f yf i r s t b r e a k p o i n t : ( :), . S p e c i f y second b r e a kp o i n t : ( :) . AutoCAD - .

    -, . Modify AutoCAD - , .

    ! , , - S p e c i f y second b r e a k p o i n t o r [ F i r s t p o i n t ] {

    P Q ! : [ ]) . -' , ,

    . , @

  • . 1. -h.dwg -.

    2. ablO-9.dwg AutoCAD Bible. , - , . 10.27. OSNAP . Intersection Endpoint.

    CHURCH BUILDING

    '-IO /4'

    . 10.27.

    ["-' 3. Break Modify. i ....-JS S e l e c t o b j e c t s : 1, . 10.27. -

    AutoCAD Specify second break p o i n t or [ F i r s t p o i n t ] : - 2. AutoCAD .

    4. BREAK, . S e l e c t o b j e c t s : ( ). - AutoCAD Specify second break p o i n t or [ F i r s t p o i n t ] : First point ( ) - . Speci fy f i r s t b r e a k p o i n t : 3. Specify second break p o i n t : 4. AutoCAD .

    AutoCAD . 4, 3, AutoCAD , .

    5. , OTRACK .

    6. BREAK. :

    Select object: 5Specify second break point or [First point]: First point Specify f i r s t break point: 6

    260 .

  • , -. , . Endpoint: 4 '-8 1/2"
  • |

    -

    , 10,29,

    . : , . AutoCAD - CHAMFER. , - , . AutoCAD , - .

    AutoCAD , , . ' , .

    . 20001, CHAMFER! , -

    , .

    \~* , Chamfer () --.'1 Modify. . AutoCAD :

    (TRIM mode)Current chamfer Dist l = 0.5000, Dist2 = 0.5000Select f i r s t l ine or [Polyline/Distance/Angle/Trim/Method]:

    AutoCAD ( -), .

    -1 Distance. AutoCAD S p e c i f y f i r s t chamfer

    d i s t a n c e : ( :) - , ( , ). AutoCAD S p e c i f y s e c o n d c h a m f e r d i s t a n c e< 0 . 5 0 0 0 > : ( :) . - , . AutoCAD .

    Angle. AutoCAD S p e c i f y chamfer l e n g t hon t h e f i r s t l i n e < 1 . 0 0 0 0 > : ( :) . AutoCAD S p e c i f y chamfera n g l e from t h e f i r s t l i n e : ( :) . AutoCAD .

    , , CHAMFER. AutoCAD -

    262 //.

  • . , AutoCAD . , , , .

    , CHAMFER. - ( ) . AutoCAD S e l e c tf i r s t l i n e or [Polyline/Distance/Angle/Trim/Method] : ( - [////]:) . . AufoCAD ( - ) ( - ), AutoCAD S e l e c t second l i n e : ( :) . AutoCAD .

    .; " "% , Polyline. ( 16, 4 " ". 24, "

    ", .)

    CHAMFER . , Trim () No Trim (He ).

    ablO-i.dwg, - Drawings -.

    . 1. abl 0 - i . dwg -.

    2. ablO-lO.dwg AutoCAD Bible . - . 10.30.

    . 10.30.

    10. 263

  • 3. Chamfer Modify. CHAMFER . , . - , .

    Select f i r s t l i n e or [Polyline/Distance/Angle/Trim/Method]: Distance Specify first chamfer distance : 0

  • FILLET

    FILLET () . . FILLET ARC () . CHAMFER, - FILLET , , , . , , , . (. 10.32).

    -

    . 10.32.

    . -. AutoCAD . - FILLET . AutoCAD - .

    - , Fillet () -^ Modify. . AutoCAD :

    Current s e t t i n g s : Mode = TRIM, Radius - 0.5000Select f i r s t object or [Poly l ine/Radius/Trim]:

    Radius () - Radius (). Specify f i l l e t r a d i u s ( :), . - , .

    , FILLET. . Se lect f i r s t ob jec t or[Polyline/Radius/Trim] : ( [//]:) . Se lect second o b j e c t : - . AutoCAD .

    ;. " % , p o l y l i n e (). ( - ^ 16, " ". 24, " -

    ", .)

    FILLET . - , Trim No Trim.

    10. 265

  • , ,

    . , . -, AutoCAD , . , - , .

    FILLET , - . FILLET , . - , , .

    abio- i .dwg, - Drawings -.

    . 1. ablO-i . dwg -.

    2. -11 .dwg AutoCAD Bible . - . 10.33.

    . 10.33.

    3. Fillet Modify. AutoCAD S e l e c t f i r s t o b j e c t or [ P o l y l i n e / R a d i u s / T r i m ] :

    Radius. Specifyf i l l e t r a d i u s 5/8< . AutoCAD .

    4. FILLET . - AutoCAD S e l e c t f i r s t o b j e c t or [ P o l y l i n e / R a d i u s / T r i m ] : 1, . 10.33. S e l e c tsecond o b j e c t : 2. AutoCAD .

    266 II.

  • 5. FILLET . - AutoCAD S e l e c t f i r s t ob jec t or [ P o l y l i n e / R a d i u s / T r i m ] : Radius. Specify f i l l e tr a d i u s ( ;) 1/4
  • . Edit Attribute Defini-tion ( ) ( DDEDIT ()). 18, " ".

    . Enhanced Attribute Edit( ) ( EATTEDIT). - 18, " ".

    . Reference Edit ( ) (REFEDIT). 18, " ".

    . Hatch Edit ( )( HATCHEDIT ()). 16," ".

    My. Multiline Edit Tools ( - ) ( MLEDIT ()). - 16, " ".

    . MultilineText Editor ( ) ( DDEDIT). 13, " ".

    ( TEXT () DTEXT ()). Edit Text ( ) ( DDEDIT). 13, " ".

    . Reference Edit ( REFEDIT). 18, " ".

    , DBLCLKEDIT, , : . , dblclkedit OFF.

    , AutoCAD

    . , , -, . Windows.

    , , . , . ( .) , .

    - , .

    , . "4"'% .

    , , - , ( (. 10.35)) . , , . - , , . -

    268 II.

  • AutoCAD , -, , "" .

    , , , , Grips (). .

    . 10.35. . -. -

    - , , . - . " ". - . STRETCH (), ROTATE (), MOVE (), SCALE, () MIRROR (). , - . AutoCAD, - , .

    , , . - , , . , . () .

    , , .

    , ,

    . , , - , AutoCAD , -. ( ). - .

    10. 269

  • CHANGE () . , - , , - . AutoCAD ;

    ** STRETCH **Specify s t r e t c h p o i n t or [Base point/Copy/Undo/eXit]:

    STRETCH () , . , . . AutoCAD . .

    Base p o i n t ( ). , , . - Grips () Base point ( ). AutoCAD Specify base p o i n t : ( ;) - . Specify s t r e t c h p o i n t or [Basepoint/Copy/Undo/eXit] : ( , [ -///]:) .

    (). M u l t i p l e (). - Grips (). AutoCAD Speci fy s t r e t c h point: or[Base point/Copy/Undo/eXit] :. AutoCAD -

    , . .

    Undo (). . Grips Undo ().

    e x i t (). Command: (:) , AutoCAD. - Grips Exit (). Command: , .

    STRETCH () -

    . STRETCH , , -

    , , , - , . , . - . , , , - , . - .

    .

    1. . , - . , - .

    270 //.

  • 2. , , - . , , , .

    3. , - , AutoCAD :** STRETCH **Specify stretch point or [Base point/Copy/Undo/eXit]:

    4. . .

    , , - .

    . ,

    . . . Grips Move (). AutoCAD :

    ** MOVE **Specify move point or [Base point/Copy/Undo/eXit]:

    , , . , -

    .

    . @ . AutoCAD . - .

    Base p o i n t ( ). , , . Grips Base point ( ). AutoCAD Specify base p o i n t : . - Specify move p o i n t or [Base point/Copy/Undo/eXit] : (, , [ ///]:). .

    (). M u l t i p l e (). - Grips (). AutoCAD : Specifymove p o i n t or [Base point/Copy/Undo/eXit] :. AutoCAD - , , , .

    Undo (). . Grips Undo ().

    eXit (). Command: (:) -, AutoCAD. - Grips Exit (). - Command: , .

    10. 271

  • ROTATE (). , . . . Grips Rotate (). AutoCAD :

    ** ROTATE **Specify r o t a t i o n angle or [Base point/Copy/Undo/Reference/eXit] :

    . AutoCAD . .

    Base p o i n t ( ). , , . Grips Base point ( ). AutoCAD Specify base p o i n t : . Specify r o t a t i o n angle or [Base point/Copy/Undo/Reference/eXit] : AutoCAD .

    (). Multiple (). - , Grips (). AutoCAD - Speci fy r o t a t i o n ang le or [Base point/Copy/Undo/R e f e r e n c e / e X i t ] :. AutoCAD , - , . .

    Reference (). , . Grips - Reference (). AutoCAD Reference ang le: ( :) - . AutoCAD : Specify new a n g l e or [Base p o i n t /Copy/Undo/Reference/eXit] : ( [ -////]:). . Reference () ROTATE ().

    Undo (). . - Grips Undo.

    eXit (). Command: (:) -, AutoCAD. - Grips Exit. Command: , .

    -

    SCALE (). , -, . . Grips - Scale. AutoCAD :

    ** SCALE **Specify scale factor or [Base point/Copy/Undo/Reference/eXit ] :

    272 II.

  • . AutoCAD . - .

    Base p o i n t ( ). , , . Grips Base point. AutoCADSpecify base p o i n t : . , Specify s c a l e f a c t o r or [Base p o i n t /Copy/Undo/Reference/eXit] : ( [ ////];) .

    (). Mul t ip le . Grips Copy. AutoCAD - : Specify s c a l e f a c t o r or [Base p o i n t /Copy/Undo/Reference/eXit] :. AutoCAD , , - . .

    Reference (). . Grips Reference. - AutoCAD Reference l e n g t h : ( :) - . AutoCAD -: Specify new l e n g t h or [Base point/Copy/Undo/Reference/eXit] : ( [ ////]:). . Reference () SCALE ().

    Undo (). . - Grips Undo.

    e x i t (). Command: , AutoCAD. - Grips Exit. Command: , .

    - MIRROR (), , . . (). Grips Mirror (). AutoCAD :

    ** MIRROR **Specify second point or [Base point/Copy/Undo/eXit]:

    . AutoCAD .

    AutoCAD . , (). - MIRROR (). . .

    10. 273

  • Base p o i n t ( ). , , . - Grips Base point. AutoCAD Specify base p o i n t : . Specify second p o i n t or [Basepoint/Copy/Undo/eXit] : .

    (). M u l t i p l e . Grips ,AutoCAD S p e c i f y s e c o n d p o i n tor [Base p o i n t / C o p y / U n d o / e X i t ] :. AutoCAD - . - .

    Undo (). . - Grips Undo.

    eXit (). Command: , AutoCAD. Grips Exit. Command: , .

    -j.dwg, - Drawings -.

    . 1. -j .dwg -.

    2. ablO-12.dwg AutoCAD B i b l e . (. 10.36). : ORTHO () OSNAP () .

    .

    . 10.36. , . :

    3. . - . , , - , - .

    274 II.

  • 4. 1 . 10.36 , . AutoCAD :** STRETCH **Specify s t r e t c h point or [Base point/Copy/Undo/eXit]:

    5. Grips - Mirror. AutoCAD :** MIRROR **Specify second point or [Base point/Copy/Undo/eXit]:

    6. . - , , .

    7. S p e c i f y second p o i n t or [Base p o i n t /Copy/Undo/eXit] : . - . - ( 0).

    8. , Exit. .

    9. , . .

    10. 2 . 10.36, . Grips Rotate. AutoCAD Specify r o t a t i o n angle or [Base point/Copy/Undo/Reference/eXit] : 90

  • , .

    AutoCAD Tools^Options (^) Selection (), . 10.38.

    IJSjOutions* ptofto Eln

    F ) N 1

    p .

    i

    i

    fcday] CpenandSeu*

    ..

    * ,-m .

    > J

    - r

    Ptottre) 5)4t

    Cutantdr*".

    n| Uf Pratowiou| * * * * "

    . a n a

    m

    J * '

    J

    . 10.38. Selection Options, -

    (.. ). -. 18, " -". ( ) . Enable Grips Within Block ( ) , , , .

    ipynne Grip Colors ( ) () . Se-lect Color ( ), .

    Grip Size ( ) . - .

    Object Property Manager

    Object Property Man-ager. Object Property Manager ( - Properties ) - AutoCAD .

    f*p| Object Property Manager -L1".^ erties () . Properties . 10.39.

    276 .

  • [Properties E:1 AutoCAD Bih1e\ati1...EI|June

    Alphabetic - OtegertwJ _jColaLayerLnetypeLnetypa scale

    s| Plot style|; Lneweight|- Hyperlnl;gi Thickriess-j aart X Start V,. Start Z

    EndX: EndV

    Er>dZ

    . ,Delta X

    Delta

    DdtaZLength

    Angl-

    I

    Sylayer

    0

    " * ~ ^ -CEI4TER1.0000

    ; Cm-'

    0.0000

    0.5000 ~

    '0.1851 " -

    Q.0000

    0.5000

    .80.0000

    Properties - Geometry (); - , .

    , , - ( AutoCAD , " ,, ").

    , - (. 13, " ").

    (. 17, " ").

    (. 28, "AutoCAD Internet").

    Properties . Catego-rized ( ) -. . 10.39 , Cate-gorized Properties, -. , Geometry, . . 10.39. Alphabetic ( ) Properties, , .

    - ObJect Property Manager, uc- . , . no.ibivemcH l i n e () . . . ,,, ' J AutoCAD

    Properties. , - - . , , S t a r t X X l i n e , . . , , , S t a r t X.

    Properties . Properties Undo () .

    () Allow clocking (~* ), Properties

    AutoCAD. . , - . ( ), .

    Properties - AutoCAD,

    Object Properties Manager , , , - , . , .

    - (), - , .

    10. 277

  • , , , - .

    - Properties , -, . .

    Quick Select ( ). - , . Quick Select (selectionset) , . .

    ? Properties .

    !

    Toggle Value of PICKADD Sysvar ( PICKADD) PICKADD. - . (.. ), . . ( ), . , .

    ^0&* P I C K A D D , , - , > , .

    , .

    . -, !" PICKADD.

    , , PICKADD . , .

    \ , PICKADD .. -1 , .

    Properties. - , .

    !

    Q_ j Select Objects ( ). -1 ,

    . - Properties. -

    278 II.

  • , Select Objects -. , .

    1. Select Objects.

    2. (, f), , , SELECT.

    3. .

    4. .

    5. Properties . ( - .)

    , Object Property Manager, - .

    Properties .

    . ,

    :

    , ;

    ;

    , .

    , , Auto LISP- , . ( AutoLISP- . AutoLISP 34, "AutoLISP Visual LISP", 35, " AutoLISP".) , . - .

    1 . 4, " ". \

    Quick Select , , -

    . QuickSelect . FILTER (), , - , - . .

    Tools^Guick Select.

    Quick Select.

    10. 279

  • Id

    Cp*\

    :* .: if**' .nWJO*

    i fipfiandai

    GK.

    LnelypgLoeiypc scilePl:t sMe

    . . - , - ,

    r lew iikcacn wil4jfn nevi MocoDn

    ! ihcfaon el

    | !

    i

    ,

    Y-'-V

    !. *.-

    1

    i . .

    1

    z J -

    " i

    * 1

    Puc. 10.40. Quick Select -

    Quick Select Object Properties Manager.

    qselect G r e a t e r than( ) < Less t h a n ( ). , -

    280 .

  • , ( * ?). .

    Value (). -, . , ( c o l o r Properties), green (). , - ( = Equals) -, ( Not Equal). ( l i n e t y p e Properties), DASHED (). , .

    How to apply ( ). , (selection set). - Include in new selection set ( ). Quick Select , - , . Exclude from new selection set ( ).

    Append to current selection set ( ). - , , , - .

    Quick Select .

    AutoCAD , . - Exclude from new selection set, AutoCAD , , , . -, S e l e c t o b j e c t s : P r e v i o u s(),

  • Object Selection I liters

    r-HsnwJFJwt Eftn tMa ! " toLitt

    l^^^tiU^T^a,",^; .

    1 Cjjner* -unnsmedN . . 2l\

    Detew CuiemfBier Ut

    '' to ; | 4 CWK* ' |

    . /0.4/. Object Selection Filters

    Select Filter ( ) Object Selection Filters

    . , (, .)* , , AND, OR NOT. - .

    . . 10.42 - . - , Add to List ( ). Ob j e c t = L i n e .

    Object

    Svbctft*

    - % - i = 4 r w ^ S r f S l f j i ^ * . ' *

    . 10.42. , Line

    . - .

    , , - . . , C o l o r () Layer (), .

    , , , Select Filter. X, Y Z

    282 .

  • . - , , , Viewport Center ( ). X - . Y Z . -, Text Height ( ), X . - , ., , , -, 0.75. C i r c l e Radius ( ), - X. . - . 10.2.

    [ 10.2. Object Selection Filters

    ! =

    <

    <

    >

    >=

    *

    , , -

    , . BEGIN - END .

    ^00"0 , Auto- ^ A D , AND.

    , AutoCAD , - .

    . 10.3 . ( AutoCAD - , .) : Color =1-Red ( = 1-) Object - C i r c l e ( = ).

    10.3. ( ),'

    AND , -

    OR , -

    10. 283

  • . 10.3

    XOR , , . - B e g i n XOR End XOR

    N O T , - . B e g i n N O T E n d N O T

    , - , -, ,

    NOT - Object = c i r c l e( = ), - , ,

    , Substitute () . , - , Add Selected Objects( ). AutoCAD , - , .

    . 10.43 , l i n e p o l y l i n e . XOR, - , , . , l i n e , p o l y l i n e . , - , Quick Select.

    jObject Selection Miters" Begin XOHObjectObpct"End XDR

    tAjfm I * ,&!&'Named fieri-

    J . , UP*; d

    71 fcTraTT_j * ....-

    UW* j Cancel | h

    . 10.43. line polyline

    . -

    , . . Save As ( ) Named Filters () Save As ( ).

    , , .

    284 //.

  • Edit item (). , , -, Edit item. AutoCAD - .

    Delete (). .

    Clear list (). Current (). .

    Current ().

    .

    , () , , . AutoCAD:

    Select o b j e c t s : ' f i l t e r ^ Object Selection Filters. ApplyApplying filter to selection.Select o b j e c t s : all

  • ( ). Value () ByLayer (). Include in new selection set ( ). Append to current selection set ( ) . . AutoCAD - .

    5. . FILTER.

    6. filter^. Object Selection Filters.

    7. Select Filter Text. Add tolist. Object = Text.

    8. Select Filter **Begin AND ( ) Add to list.

    9. Select Filter Color. X: ! = ( ). Select. - BYLAYER Select Color. . - Object Selection Filters Add to list. - 2 56, BYLAYER (). ( .)

    10. Select Filter Text Height, - < X: .1. Add to list.

    11. Select Filter **Er.d AND - Add to list.

    12. Save As Bad text. Object Selection Filters , . 10.44.

    I Object Selection I-litersObiect"" BeginCo lot He" E n d

    AMD

    ghtAND

    = Text

    ' 256 By Layei< 0 1000

    SetectFBH

    -["End AND

    Substitute

    # ' f '" j Named Fitefs - .*- "; - Cu'ent- jbadlexl1 SaveAs: ;j tad left

    " Detae'DwefttFJUerUst

    List

    t

    Add Selected ObjecK

    . 10.44. , BYLAYER

    13. Apply.

    14. S e l e c t o b j e c t s : al!

  • 15. Color Control Object Properties. - ByLayer. AutoCAD , .

    16, .

    , , Quick Select - , FILTER, , -, .

    (.. ),

    . , , , - , .

    , group

  • 2. Description () 64 . .

    3. New (). AutoCAD - S e l e c t o b j e c t s :. 1 - , . , . AutoCAD .

    4. .

    .

    ^0$^ .

    Group identification ( ) Object Grouping Find Name ( ). , . AutoCAD - , ( ).

    Highlight () -. Group Name ( ) , Highlight AutoCAD ipynne. Continue () AutoCAD . Highlight , .

    Change Group ( ) Object Group-

    ing . ipynny, Group Name . Change Group . .

    Remove (). , AutoCAD S e l e c t o b j e c t s to rerr.ove from group. .. ( ...). , . . AutoCAD . .

    Add (). , AutoCAD - S e l e c t o b j e c t s to add tog r o u p . . . ( ...). , - . - . AutoCAD . .

    Rename (). , , Group Name . Rename. Group Name . .

    Re-order (). ipynne , 0.

    288 II.

  • (, , ). - , .AutoCAD Order Group ( ). , , Reverse Order ( ). Highlight Previous. O b j e c t : 0 (:0), . Next (). - , , . - Order Group. :

    Remove from position ( ) , ;

    Replace at position ( ) ;

    Number of objects ( ) , .

    Description (). . Group Identification . Description.

    Explode (). . , .

    Selectable (). , . , - . - .

    . ,

    , . . , Selectable. , .

    Selection () -. Tools Options ( ). , Object Grouping( ) Selection Modes ( ).

    ^\ -k.dwg, - KOiinjarf- Drawings -.

    . 1. ablO~k.dwg -.

    2. -14 .dwg AutoCAD Bible . (. 10.46).

    10. 289

  • ( ORTHO () OSNAP () ). - Endpoint ().

    . 10.46.

    3. group^ Object Group-ing. switch Group Name. , Selectable() . New ().

    4. AutoCAD S e l e c t o b j e c t s : - AIR DAMPER SWITCH, 1 2 . 10.46.AutoCAD , . . AutoCAD Object Grouping. .

    5. Copy Object () Modify. - AutoCAD S e l e c t o b j e c t s : - , . AutoCAD 1 found (I -). .

    6. Speci fy base p o i n t or d i s p l a c e m e n t , or[ M u l t i p l e ] : - Multiple. Speci fy base p o i n t : 3, . Speci fysecond p o i n t o f d i s p l a c e m e n t o r

  • (). CHAMFER () FILLET () -, .

    , AutoCAD . : Move (), Mirror (), R o t a t e (),Scale () S t r e t c h (). - ().

    , , - Object Properties Manager.

    Quick Select -, . - FILTER ().

    , . , . - , .

    , , - .

    10. 291

  • ... (

    *

  • , , . , . (layer), (color) (linetype) - {object properties). . , , .

    ,

    . - . , , - , , , , - , , (), , .. - , , , .. -, , , - .

    ( - 5, " "). , .

    .

    , .

    , .

    . , , .

    .

    , .

    . , , . 17, " ".

    , , .

    0, / , ( C o n t i n u o u s ) ( D e f a u l t ) .( 0.010 0.25 . - 0.) ,, . .

    , (states). , .

    On/Off (/). (On) . - (Off) , .

    Thawed/Frozen (/). (Thawed) . -, .

    11. - , , 293

  • . . , . 17, " ".Unlocked/Locked (/). . , . , : , .

    Plottable/Not Plottable ( / ). , , NotP l o t t a b l e , . , ON() THAWED (). - .

    , Layers () Object Properties ( ). AutoCAD Layer Prop-erties Manager ( ), . 11.1. . , .

    UJIJLdyer Prupeilies

    +time

    * * *

    ObjectsDim

    J rf> (fWWte ContinuoiRQ rf1 B B e d ContinuousJ rf1 Q'een Continuous

    ~ *

    -JL-M

    ' U

    5

    ' * - '

    . 11.1. Layer Properties Manager - Show details Details

    294 II.

  • . 11.1.

    11.1. Layer Properties Manager --'

    Name ()

    On/Off (/)

    Freeze/Thaw in all viewports(/ )

    lock/Unlock

    (/)

    Color ()

    Linetype ( )

    Uneweight ( )

    Plot Style ( )

    Plot ()

    Active VP Freeze(/ - )

    New VP Freeze(/ )

    , O n / o f f

    , F r e e z e / T h a w

    , L o c k / U n l o c k

    ,

    ,

    ,

    , ( 17, " ")

    , /

    , f r e e z e / t h a w(/) (, )

    , f r e e z e / t h a w ( , - - )

    , , ,

    Layer Properties Manager. -

    , .

    New (). , AutoCAD -

    Layer 1 ( 1), . 11.2. -, , . , . , AutoCAD , . , , - , 0.25 , .

    . 11.2. Layer 1. . AutoCAD ,

    11. - , , 295

  • 255 . - ";?*|,+'.

    , New , . -

    . , /%&\ , , ,

    New. - , . - .

    , , -

    , . , - Color (). , Select Color ( ), . 11,3.

    OSelect Color

  • AutoCAD . AutoCAD , . , , - . , Select Color , AutoCAD . , Toots&Opttons(^), Display () Colors ().

    (Continuous). , AuloCAD

    (linetypes), / . (shapes). .

    , , , . , Select Linetype ( ), . 11.4.

    . ! 1.4. Select Linetype

    , - , , . - , . Load (), Load or Reload Linetypes ( ) . 11.5.

    jjLodd OF Reload Line types

    Lmrtwe\CAD ISOOWIOO1CAD ISOOJwlOO\CAD IS004W10Qa.CAD IS005V/1CO\CAO ISO0EW1G0iCAD IS003W1001CAD ISO03V10OACAD IS01CW1001WD ISO11W100

  • , . l i n . AutoCAD a c a d . l i n . - a c a d . l i n . l i n . a c a d . l i n , , File () . , - , .

    31,( " ",

    , - , . , . - .

    , , Select Linetype. - . .

    Layer Properties Manager. - , , . - .

    ,

    . , "" , , - , . Auto-CAD LWT - / -. , , ().

    - Lineweight Lineweight (. 11.6). .

    .

    . 11.6. - Lineweight LayerProperties Manager - Lineweight. , -

    AutoCAD , - DEFAULT. 0.010 , 0.25 . ( Model AutoCAD), , . 0 -

    298 //.

  • l i n e w e i g h t 1 . -. - .

    ( 17, " - ") AutoCAD , - , .. , . : - .

    l i n e w e i g h t . AutoCAD Format^Lineweights(^ ). AutoCAD LineweightSettings ( ), . 11.7. Lineweights . - , Default ( -). AutoCAD 0.01 , .. 0.25 . Adjust Display Scale ( - ) - . , - . Display Lineweight ( ) LWT . .

    J|j2Linewt'ii|l>t Settings

    . 11.7. Lineweight Settings AutoCAD

    , , .

    , . , Layer Properties Manager .

    abl l-a.dwg, - Drawings -.

    11. , , 299

  • . 1. a b l l - a .dwg -.

    2. 1-1 .dwg AutoCAD Bible .

    it-jj 3. Layers () Object Properties?> ( ) Layer Properties Manager.

    4. New. Layer 1, . wallsO.

    5. Color (), Select Color. (Standard Colors) . Color () blue.

    6. New () . - hidden .

    7. Details () , - Show details ( ). Color() Details () magenta ().

    8. CONTINUOUS () , - hidden. Select Linetype ( ). Load () Load orReload Linetypes ( ). , HIDDEN (). - . Select Linetype ( ) HIDDEN () . , Layer Properties Manager, .

    9. Layer Control () Object Properties ( ) AutoCAD , . -, .

    10. .

    Current () -

    Layer Properties Manager. , , . - - LWT , .

    AutoCAD . - . Layers - Object Properties: , Current . -

    8 - Layer Control ( ) Object Properties ( ),Layer Control . 11.8.

    300 //.

  • Layer Control .

    , .

    , ().

    , . - , .

    ^00* , Layer Control , AutoCAD ,

    , .

    Layer Control , . - , . , , . - Layer Control :

    ;

    :

    On/Off (/),

    Frozen/Thawed (/),

    Frozen /Thawed in Current (Float ing) Viewport (/- () ),

    Unlocked/Locked (/),

    P l o t t a b l e / N o t P l o t t a b l e ( / );

    .

    , , .

    , ,

    Layer Control, , -. : , - . : , . , .

    .

    Object Properties AutoCAD 2002 . , Layer Previous (), ,

    ! . .

    Wvu , -: Layer Control.

    11. - , , 301

  • , ,

    , , . , Layer Control ( -). Layer Properties Manager (). .

    On/Off (/). , . , - O b j e c t , . - . , , - O b j e c t , . - Ob j e c t , .

    Thawed/Frozen (/), , . : - , .

    Unlocked/Locked (/). , . - - , , - .

    Plottable/Not Plottable ( / ). " " , - - -, . - , . . " " .

    Off Frozen . - AutoCAD

    - On/off Thawed/Frozen. - , AutoCAD - , - . , , A e r i a lview ( ), Zoom Dynamic ( ), - . , , , . , , , - , On/Off Thawed/Frozen.

    , - . , , -, . . 11.2 .

    . -, . , ,

    302 II.

  • 11.2.

    On ()

    Trawed ()

    Trawed () -

    Trawed ()

    Unlocked ()

    P l o t t a b l e ( )

    O f f ()

    Frozen ()

    Frozen () -

    Frozen ()

    Locked ()

    Not P l o t t a b l e( )

    , , .

    , ,

    . , - - , . - , - . , , , .

    f AutoCAD 2000, '} * , -

    ' .!

    . , , . , - . AutoCAD - , .

    . , .

    , , .

    1. . , -, , .

    11. , , 303

  • 2. Layer () Object Properties (), Layer Properties Manager ( ).

    3. Save State ( ). , . 11.9.

    Pw . /.9. Save Layer States( )

    4. New layer state name ( ) - .

    5. , .

    , - , . , - On/Off , , , .

    !

    6. .

    , , Layer Properties Manager Restore State ( ). LayerState Manager ( ), . 11.10. - Restore (), - , Layer Properties Manager.

    ILayer States Manager

    . 11,10. Layer States Manager

    , Layer States Manager - .

    304 .

  • Restore (). Restore ().

    Edit (). EditLayer State ( ). - .

    Rename (). .

    Import (). , - . las . , .

    Export (). . l a s . .

    Layer States Ma-nager, Close ().

    -

    . , Layer Control. - .

    Properties, Properties Object Properties. , , .

    . , - ( ), -

    ! Layer Control .

    v ,

    1~ . , , , Layer Control, . AutoCAD - : MakeObject's Layer Current ( ) Object Prop-erties. AutoCAD .

    abl l-b.dwg, - Drawings -.

    . 1. abl 1-b. dwg -.

    2. 1-2 .dwg AutoCAD Bible . - . 11.11. 0. - Endpoint Quadrant.

    11. - , , 305

  • 1" HOPE DWPLES

    GAS EXTRACTION WELL PLAN

    . 11.11. . - - (U.S. Army Corps of Engineers)

    3. Layer Control. Pipes (), Pipes .

    4. LINE (). 1 2(. . 11.11), ( Quadrant).

    5. Layer Control Object, Object.

    6. Layer Control - On/Off (/) ( ) Dim. , .

    7. CIRCLE (). 2 , . - 3 4 (. . 11.11), ( Endpoint).

    8. , CIRCLE 2. - 5 6 (. . 11.11).

    9. . , . Layer Con-trol Pipes . , - . Pipes . , Layer Control - Obj e c t .

    10. ( Pipes). Object Properties Make Object's Layer Current {

    306 .

  • ). P i p e s . ( 1) ( 5 6).

    11. , , -. Layer Control T e x t . , . GAS EXTRACTION WELL PLAN ( -). Layer Control T e x t . , .

    12. . , . 11.12.

    6-MNCRETC FILLED S T E E L P I P E S

    1 / 4 " T H R E A D E D C A S

    W M P U N C T O R T

    H C P E D R I P L E C

    G A S E X T R A C T I O N W E L L P L A N

    . 11.12.

    - Delayer, AutoLISP, . - \Software\Chapll\Delayer. , - , , , . \ s o f t w a r e \ c h a p l l \ L l . , - Cnl , . \ s o f t w a r e \ c h a p l l \ C n l .

    , .

    , . -

    , . . Layer Properties Manager ( ).

    11. - , , 307

  • , -

    . , . , , . , - MAXSORT, . , - , ,

    . -

    Layer Properties Manager . , . . Named Layer Filters () .

    , , Invertfilter ( ). Layer Control Object Properties, Apply to ObjectProperties toolbar ( ).

    AutoCAD , - . Named Layer Filters ( ), . 11.13.

    Named Layer 1-liters

    '

    :

    CuMnttenpat:

    Hew viewport:

    Lock/Unlock:

    B * ' ,

    & * . - ' " . -

    Lineup* r

    jd blue

    (BothJBothJBothJBath(Both

    - JBothJBlue!"

    zl

    zlzlzlzlzlzl

    . 1J. 13. Named Layer Filters

    , (/, -/, /, /), , . , - . *(), , ? ( ), -

    308 II.

  • . . 11.13 , - d*. , . , - , d.

    Filter name, Add (), Close (). - Named Layer Filters, AutoCAD . - Object Properties.

    , - . . , ,

    , t - t i t l e , t-notes, t - t a b l e .' -

    , , , .

    , Layers () Object Properties. AutoCAD Layer Properties Manager( ). .

    Show details ( ), - . , -. Details () Color () . ( - , , O t h e r s() Select Color ( ). , .) , Layer Properties Manager.

    , -, AutoCAD Select Color ( ). - , .

    , , . - , Details () . , , , Select Linetype ( ). , .

    Layer Properties Manager l i n e w e i g h t . - Lineweight ( ).

    . - Layer Properties Manager, -

    Select ( ) . %%'- , Clear All ( ).

    , - . , --, . - .

    11. - , , 309

  • .

    . . AutoCAD .

    Layers Object Proper-ties Layer Properties Manager. . , . .

    ^ f ^ 0.

    Layers Object Properties,

    Layer Properties Manager. . Delete () .

    , -Tta . 0, .

    D E F P O I N T S , AutoCAD , . , ( 19, " ").

    ,

    . . , , . PURGE () -, .

    Purge () AutoCAD 2000i. .

    !

    , Drawing Utilities^ Purge (^^). Purge(), . 11.14.

    ^^00** Incremental save percentage ( %) Open and Save ( ) Options ()

    PURGE / , . , ' , , , -

    PURGE.

    , , : , , , , , , ? - , . - Purge, , .

    310 II.

  • "

    itrn . ztrrti t g t

    1 - , H I ,

    Mbne slatesPlot stylesShapesTenlstytei

    I v

    /. 14. Purge

    , , View items you can purge( , ). , - , "+". , . 11.14 -, , . -, , "+".

    , Purge (). , - , , - Confirm each item to be purged ( ). , , Purge All( ). , , - Purge nested items ( ). , , .

    . , - , .

    , , '\ , , , .

    abl l-c.dwg, - Drawings -.

    . 1. 1- . dwg -.

    2. a b l l - 3 .dwg AutoCAD Bible. - . 11.15.

    11. - , , 311

  • TOP

    FRONT RIGHT SIDE1VINSTON RESEARCH

    Puc. 11.15. 44 . (Michael J. Lemmons),Winston Products Company, , .

    Layers Object Properties Layer Properties Manager. Named layer filters. Filter name layers. Layer Names ( ) *, , - . Add, Close. LayerProperties Manager layers. Layer Properties Manager , . 11.16.

    4FLRSTK _96014FLRSTK..NT_695P01MUFFHAF_A33P02MUFLR_SEAT_B99P01MYDIMS

    rf1 BBlue CONTINUOUStf CONTINUOUSrf1 206 CONTINUOUSrf> QGieen CONTINUOUStf White CONTINUOUS

    DefautDeladtDefaullDefauMDefaul

    NttmalNormalNormalNormalNormal

    Puc. 11.16. Layer Properties Manager ,

    4. . , . , Mydims. Details () ( Show details( ), ) Linetype ( ) Dashed(). . , . AutoCAD .

    312 II.

  • 5. Layer Properties Manager , Layers Object Properties. Mydims. , . Titles - . . : AutoCAD - . .

    6. ERASE (), - ( ) FRONT (), ( ) RIGHT SIDE ( ). - .

    7. Layers Object Properties, Layer Properties Manager. , T i t l e s , . Named layer filters Show a l l l a y e r s . T i t l e s . Delete ().AutoCAD , . .

    8. .

    ,

    , . , AutoCAD, , , . - , .

    . ,

    , , , , , .

    Color Control( ) Object Properties ( ), - . 11.17. Layer Control ( ), Color Control ( ) . , -. AutoCAD ByLayer, . 11.18.

    ByLayer , . - Color Control Layer Control( ) .

    . 11.17. Color Control Object Properties

    EtyLayei hr lock RedD Yellow Green Cyan BlueD Magenla '__

    Cola 12

    11. - , , 313

  • Color Control

    ' ' U *

    EAAuluCAD Bible ab 13 i1...E3

    . 11.18. ByLayer. - (Jerry Bottenfield) Clow Valve Company, , .

    . - , , , - , . -, , , -, . AutoCAD - .

    , - -. , - ( , ). , ( ). .

    .

    ColorlayerlinetypeUnetype scalePlot styleUieweight

    Thickness

    Geometry

    Start X

    5tart Y

    Start Z

    EndX

    End

    EndZ

    Delta x

    Delta t

    Delta Z

    Length

    Angle

    ByLayer

    0.0000

    ?,7440

    .526

    0,0000

    3.4964

    3.5826

    0.OO0O

    . - Color Control .

    -, Properties

    () .AutoCAD Properties (. 11.19). , Color () , - , . .

    ByLayer.

    . 11.19. Properties

    314 II.

  • , -

    , . , - . . , , , - ( ) . , . ByLayer , .

    , ColorControl . ByLayer - Color Control ByLayer.

    , ByBlock. ByBlock 18, " ".

    .

    , . -

    . , - . , , .

    . 11.20 Linetype Control( ) Object Properties, - . Linetype Control - . , , - . AutoCAD ByLayer.

    . .20. LinetypeControl Object Properties

    HIDDEN;ByLayer jByBlock -.

    CDNT...UOUSf'

    Other

    ByLayer , , , .

    . , , , . , , , , , . , AutoCAD.

    .

    . Linetype Control .

    Properties Object Properties. AutoCAD , -

    11. - , , 315

  • . , -. , Linetype ( ) - , , . .

    ByLayer .

    , . ( Object Properties, - Properties) Other (), - , . LinetypeManager ( ), . Load(), Load or Reload Linetype ( - ), ( acad. l i n ) , . . - , .

    , , Linetype Filters ( ), Linetype Manager ( ).

    , -

    , . - . . , - ( ), , . , , , , . - ByLayer , .

    , Line-type ( ) , , , . ByLayer Linetype ByLayer.

    . , -

    , , -. , , , - . , - , , .

    AutoCAD , . Lineweight Control Object Properties (. 11.21). - , .

    316 II.

  • , - , ByLayer.

    . 11,21. LineweightControl Object Properties "

    ByL er

    ByBlock Defaul 000 mm0.05 mm 0.09 mm0.13mm015 mm0.18 mm

    , . - , AutoCAD .

    . Lineweight Control( ) Object Properties .

    ?. , -\.: Properties . AutoCAD

    Properties. , - L i n e w e i g h t , - , - . , .

    , -

    . AutoCAD . ByLayer.

    , - Lineweight Control .

    a b l l - d . d w g , - Drawings -.

    . 1. a b l l - d . dwg -.

    2. 1-4 .dwg AutoCAD B i b l e . - 11.22 - .

    3. . , - , , Linetype Control, M a g e n t a (). . Color Control ByLayer. , .

    4. , ( .) , - Color Control Red (). , .

    11. , , 317

  • 5. 1 2, . 11.22. - Linetype Control ( ) - H i d d e n (). .

    6. , -. Lineweight Control 0.30 mm. - . LWT . - , .

    7. Color Control - Cyan ().

    8. RECTANGLE (). . COPY (), . ( - 3 4 ,) - .

    9. . , . 11.23.

    \

    &

    ELEVAB2NSCLE : --"

    . 11.22. . : - - (U.S. ArmyCorps of Engineers)

    . ,23. : -

    , , ,

    , , . ( - .) -

    318 //.

  • , - . , , -, - . , :

    ;

    () ;

    .

    . - , , , - Dashed, Dashed2 Dashedx2, . 11.24.

    _.. Dashedx2- Dashed

    Dashed2

    . 11.24. Auto-CAD , - Dashed, Dashed2u Dashedx2

    AutoCAD a c a d . 1 in , - (International Standards Organization ISO). - ISO . , , AutoCAD. . 11.25 , ISO, AutoCAD. , .

    AutoCAD

    ISO

    . 11.25. , ISO, AutoCAD

    , - , . AutoCAD - - . 1, , , -, . ,

    11. , , 319

  • 1, ; , , , AutoCAD - . . 11.26 - 0.5, 1 2. , 2 , 0. 5 . 1 . ( .)

    !

    f

    i

    i

    ""

    1 |i = 0.5 = 1 = 2

    . 11.26. , 0. 5, 1 2

    , - , . . , , , 1:96.

    , , . ( 5, " ".) , , - 1=96, - 24 48.

    , Format^Linetype - Linetype Manager (. 11.27). , , , Show details ( ).

    [ Line type Mdiidtier

    I Sho

    CurartUnetype: CONLJnstweiyLayeiiyBlock3ORDER3ORDER23ORDERX2TENTER:ENTER2DENTERX;

    tMKftJS - -..

    1 Amaranee - 1 0

    . _

    -

    ~

    eecwtion ' | *

    _ _ _ _ _ _ . _

    Puc. 11.27. Linetype Manager

    320 II.

  • Global scale factor ( ) - . . AutoCAD , - , .

    LTSCALE. , .

    , - . , , , . AutoCAD , , , , . , .

    , Format^Unetype

    Linetype Manager (. . 11.27). , ; , Show details ( ). Current object scale ( ) . . , , .

    CELTSCALE.

    , celtscale . 1, AutoCAD

    . , - 12, 0.5, 6.

    ,

    , . Properties -. Properties L i n e t y p e S c a l e - . . .

  • . 11.28. , . - (Robert Mack),Dexter Company, , .

    3. Format^Linetype Line-type Manager. , Show details ( ). Global sca le factor( ) 0 . 5 . . Auto-CAD . , , - 1 - .

    4. 1. Properties -. L i n e t y p e S c a l e 0 . 5. . , . , , 0.5 ( ), 0.5 ( ), 0.25.

    5. . , . 11.29.

    \ v

    \ \ \

    j I !

    . 11.29.

    322 II.

  • - AutoCAD DesignCenter, - , , , .. AutoCAD DesignCenter . 26, " ", .

    AutoCAD DesignCenter. AutoCAD DesignCenter (. 11.30). - Windows Explorer. - - . -, ( , ). Preview DesignCenter - , .

    I DesignCenter

    lablO-ddwg _*I 0-. dwgI 0-fdwgI 10-g dwg

    -hdwgI -idwgI abl O-i dwgI ablO-k.dwgI abli-adwgI abl 1 - dwg

    1 - dwg

    1-ddwgI ab11-edwg

    HacksI Dimityles

    H:\ab11-e.dwg\Layem (9 ffemfi

    - , - " + " . , ( - ). , - ( ). - , -, . - .

    ( ) . - Object Properties .

    DesignCenter Close .

    Puc. 11.30. AutoCAD DesignCenter - -

    AutoCAD 2002 , ., , dashed h i d d e n . -, . - 26, " ".

    , Format Painter, -

    Windows. AutoCAD , -

    11. , , 323

  • , , . AutoCAD (matching properties). Paste Special Excel, , - , , , ..

    , . - ( ). - .

    1. , ( ).

    | 2. Match Properties ( ) &.& . AutoCAD : S e l e c t d e s t i n a t i o n o b j e c t {s) or

    [ S e t t i n g s ] : ( () []:).

    ^000^ Match Properties - , .

    3. , (), , .. ().

    4. , Settings () ( s

  • . 1. a b l l - f . dwg -.

    2. a b l l - 6 . dwg AutoCAD Bible. - , . 11.32.

    4.

    5.

    CL

    MASTER SUITE

    . .32.

    3. 1, . 11.32. MatchProperties . S e l e c t d e s t i n a t i o nob jec t (s) or [ S e t t i n g s ] : , -. , . AutoCAD - , .

    MASTER SUITE. Match Properties - . S e l e c t d e s t i n a t i o n o b j e c t (s)or [ S e t t i n g s ] : Settings() . Property Settings( ) Special Properties (), Text (). .

    S e l e c t d e s t i n a t i o n o b j e c t (s) or [ S e t t i n g s ] : - CL. -. AutoCAD . , CL. .

    6. .

    11. - , , 325

  • , . -

    , . , , . Layer PropertiesManager ( ). , - . .

    : On/Off (/), Thawed/Frozen (/), Unlocked/ Locked (/) P l o t * a b l e / N o tP l o t t a b l e ( / ). - , . , . -, - . , . , .

    , . , - , . .

    AutoCAD DesignCenter , , (, ) . AutoCAD - Match Properties ( ), - ( ).

    326 //.

  • 1

    utoCAD -. -

    , - , - ( ).

    . , - , - . Auto-CAD, - , - .

    , . - - .

    STATUS () AutoCAD

    , - . Tools^Mnquiry^Status( => 1^ ).

    ...

    :. : .

    AutoCAD

  • . 12.1 .

    Model space usesDisplay showsInsertion base isSnap resolution isGrid spacing isCurrent space:CuCuCuCuCuCuCu

    renrenrenrenrenrenren

    layout:layer.color:linetype.lineveightplot styleelevation

    Fill on Grid offObject snap modesFree dwg disk (H>Free tonp disk. (CFree physical mo

    X. 40'X: lO'-SX: 29'-SX- 5'-2 1X: 35'-EX: 0'X. X: 0'

    Model spacModel0"BYLAYER BYLAYER BYLAYERByLayerD'-0- th

    Ortho off OtEndpomt.

    space: 0 KByt) space 4 36 0: 8 Mbytes

    Free svap file space- 439. Hbyt

    -8" Y:1^8" }j^8" ^5^64"1/32"-0" Y-1" Y-0" Y-

    e

    SS'-* 33

    1-! S/8-

    4-10 43--64-Y 33'-0 1^16" SD'-O 15^64"

    0'-0" Z. O'-CT0 ' -1"0'-0*

    7 (white)CONTINUOUS"

    lcknessext off

    esHBytes(out ol

    es (out

    O'-O-Snap off Tablet off

    127 5)of S68 0)

    . 12.1. , - STATUS

    AutoCAD () -, . , , . , F i l l (), . AutoCAD - . - .

    STATUS. , , - Object Properties ( ). , , , - , . STATUS - . , , - , .

    STATUS . , AutoCAD, , . 12.1, , . , . , - , , .

    5, " ", , AutoCAD

    . , , , LTSCALE, - CELTSCALE. . SETVAR () . SETVAR, - , .

    , , , . 12.2, .

    328 II,

  • Press ENTERCECOLORCELTSCALECELTYPECELWEIGHTCHAHFERACHAKFERBCHAMFERCCHAMFERDCHAMMODECIRCLERADCLAYERCHDACTIVECMDDIACMDECHOCMDNAHESCMLJUSTCMLSCALECMLSTYLECOHPASSCOORDSCPLOTSTYLECFROFILECURSORSIZECVPORTDATE

    to continue""BYLAYER"1.0000"BYLAYER"-1l'-O-l

    p-0"

    O'-O"000--0""0"11111 SETVAR"01.0000"STANDARD"02"ByLayer""Ellen""Model"522452001.79166065

    (read only)

    (read only)

    (read only)

    (read only)

    INSUNITSDEFSOURCEINSUNITSDEFTARGETISAVEBAKISAVEFERCENTISOLIHESLASTAHGLELASTPOINTLASTPROMPT

    1115040O'-ET.O'-OVO'-O""LASTAHGLE 0

    (read ..." (read only)LAYOUTREGENCTLLEHSLEHGTHLIHCHECKIIMMIHLISPIHITLOCALELOGFILEHODELOGFILEHAMEonly)LOGFILEPATHLOGIWNAMELTSCALELUHITSLUPRECLUDEFAULTLWDISPLAYLUUNITS

    24-2"09'-8",58'-"O'-0".0

    --0"

    1'ENIT0ipD:\progran filesNautocad

    "D Vprogran filesNautocad"e inkels"24.00004f>25OFF1

    (read only)

    (read only)

    (read only)

    20D2\ABll-F_l_l_0559.log" (read

    2002\'(read only)

    . 12.2. , SETVAR

    , (read-only), , LOGINNAME, , - . .

    . 12.2 , CELTSCALE 1, LTSCALE 2 4 . ( .) BLIPMODE, 5, " ", . - On () Off (), . 1 (On), 0 (Off).

    .

    12. 329

  • . 11," , , ", , - LTSCALE, Linetype Manager( ). , - , .

    SETVAR ( ), . AutoCAD SETVAR . .

    , Tools^ lnquiry^SetVariable (^^). E n t e r v a r i a b l e name or [?] :( [?]:) ? : ( :) , , ( * ?). AutoCAD , .

    , AutoCAD . , CELTSCALE

  • .1. 12,1

    T o t a l e d i t i n g t i m e , , ( ) ,

    E l a p s e d t i m e , , -( ) ,

    N e x t a u t o m a t i c save in , -( ) . Tools^Options (^)

    Open and Save ( ), -, AutoCAD

    T o t a l e d i t i n g t i m e ( ) - , a E l a p s e d t i m e ( ) ( - , ).

    AutoCAD E n t e r o p t i o n [Display/ON/O F F / R e s e t ] : ( [///]:). D i s p l a y () , . - ON () OFF () (elapsed time). R e s e t () .

    26, " ", , - .

    abl2-a.dwg, - Drawings -.

    . 1. a b l 2 - a . d w g -.

    2. Tools^lnquiry^Status. , , . . -, . . , .

    3. Tools^ lnquiry^Set Variable. - E n t e r v a r i a b l e name or [?] : ? : - . BLIPMODE. , (DWGPREFIX). , - (LTSCALE ). , Command: (:).

    4. , SETVAR E n t e r v a r i a b l e name or [ ? ] : Itscale^. 50

  • 5. Tools^lnquiry^Time. , AutoCAD (AutoCAD ). T o t a l e d i t i n g time, , - . .

    6. . , - .

    , -

    .

    LIST () .

    , . , LIST . , Tools^lnquiryOList (^^).

    . 12.4 .

    LINE

    Handlefron point.to point.

    Length -0'-1 1/2Delta X

    =X-X'

    = 0

    Layer1 "object

    Space Mode1 E3AD(-4 9'64" -0--S 41^6 4" YAngle in X'l

    '-1 1--2'. Delt

    pa

    0*QPI3

    ce

    -1'-1aneY -

    3^64"3^64'

    D

    Z -

    Z -

    0

    ' - a " .

    0 - - 0 "

    C ' - Q "

    D e l t a Z - C ' - O "

    . 12.4.

    . 12.2 LIST.

    [ 12.2. , L I S T

    Layer () AutoCAD , . ByLayer ByBlock, AutoCAD

    Space () AutoCAD , . ( 17, " ".)

    Handle () . AutoCAD , -

    From p o i n t ( ) AutoCAD ,

    p o i n t ( )

    Length () Angle in XY Plane . , ( XY)

    D e l t a ( X) X

    D e l t a Y ( Y) Y

    332 II.

  • Object Properties ( ) , . : , , , Object Properties ( ).

    AutoCAD .

    Tools^lnquiryODistance (^^). AutoCAD . , . , , :

    Distance = 19' - 0 " , Angle in Plane = 270, Angle from XY Plane = 0Delta X = O'-O", Delta Y = - 1 9 ' - 0 " , Delta Z - O'-O"

    ( - 14, " ") , .

    , . -

    Tools^lnquiry^lD Point (^^). AutoCAD - . , - . :

    P o i n t : X = 61'-5 1/8" Y = 32'-4 5/8" Z - '-"

    , .

    abi2-a.dwg, - Drawings -.

    . 1. abl2-a.dwg -,

    . - , . 12.5. Endpoint ().

    2. Tools^lnquiry^List. S e l e c t o b j e c t s : - 1, . 12.5. . 12.6. , , .

    3. ToolsOlnquiry^Distance. Speci fy f i r s tp o i n t : , 2 (. . 12.5) - . Speci fy second p o i n t : 3. :D i s t a n c e - 2 7 4 0 . 9 0 , Angle in XY P l a n e = N 89d2.3'34" E, Anglefrom XY P l a n e - EDelta X = 2740.75, Delta Y = 3450.58, Delta Z = 0.00

    12. 333

  • . 12.5.

    centerradiusstarteric

    length

    ARC

    Handlepo i n t.1937.

    angle Sangle S

    434.

    Layer:Space

    7D3951X- 7249.3589d28'5676d38

    119

    26

    -Model

    24 V

    " " V

    space

    37E3.29 Z= 0.00

    Puc. 12.6. LIST

    4. Tools^lnquiry^lD Point. Speci fy p o i n t : , 4 (. . 12.5). :X = 6065.67 Y - 3450.58 Z = 0.00

    5. . , - .

    !

    , Drawing Units ( )( Formats-Units (^ )), - LIST, DIST ID.

    AutoCAD . , AREA (),

    Tools^lnquiry^Area ( ).

    , , - . - . AutoCAD , . AutoCAD , . , .

    O b j e c t (), . , . -

    334 II.

  • , , , , -, . (, , - 16, " ".) AutoCAD - , . . , , , AutoCAD : S e l e c t e d o b j e c t d o e s n o t h a v e an a r e a( ). . AutoCAD , -, .

    , Add () - . . , - Add, - AutoCAD . . - S u b t r a c t ().

    . 12.7 . , - .

    BOUNDARY (). ( 16, " ".) O b j e c t AREA . , BOUNDARY , (. 12.8).

    . 12.7. -

    . 12.8. BOUNDARY , AREA

    abl2-a.dwg, - Drawings -.

    12. 335

  • . 1. a b l 2 - a . d w g -,

    .

    2. D (. 12.9) ZOOMWindow ( ). .

    336

    . 12.9. AREA D

    3. Tools^lnquiry^Area.

    4. Specify f i r s t corner p o i n t or [Object/Add/Subtract j :( [//]:) Add () . Specify f i r s t corner p o i n t or [Object/Subtract ] : ( - [/ ]:) 1 (. . 12.9), . Specify next c o r n e r p o i n tor p r e s s ENTER for t o t a l (ADD mode) : ( Enter ( ):) 2, 3, 4 5. . AutoCAD ( , ).

    Area = 123575.16, Perimeter = 1480.17Total area = 123575.16

    5. Specify f i r s t corner p o i n t or [ O b j e c t / S u b t r a c t ] : 6 (. . 12.9). Specify next corner p o i n t orp r e s s ENTER for t o t a l (ADD mode) : 7, 8 9. - , . AutoCAD - { t o t a l area). - .

    II.

  • Area = 183399.88, Perimeter = 1884.62Total area = 306975.04

    6. He . , .

    M A S S P R O P () , (, , ). , - , , - .. M A S S P R O P 24, " - ".

    Object Property Manager

    , Properties () Object Properties. . 12.10 Properties, - . 11," , , ", , , . : , () - X, Y, Z, , , LIST. .

    Proi)eripes-E:ViuloCADBiijle>dlf9-7.tlwn E3I

    . /2.10. Properties -

    AutoCAD

    . DIVIDE () - . MEASURE () . . - - .

    12. 337

  • DIVIDE () . -

    . -- , Node.

    , Draw^PointODivide(1^ ). , . AutoCAD - E n t e r t h e number of segments or [Block] : ( []:). . AutoCAD .

    , - Format Point Style (^ ). D I V I D E

    . .

    , , , AutoCAD . , - .

    , , - Block (). ( 18, " ".) , AutoCAD Enter name of blockto i n s e r t : ( :). .AutoCAD : Align block with o b j e c t ? [Yes/No] : ( - ? [/] :). Y

  • .

    G A S V A L V E

    I G N I T I O N M O D U L E

    I

    P O W E R

    V A L V E

    S E N S O R

    G R O U N D

    _ JYEL

    . 12.11. . (Robert Mack), Dexter Company, , .

    , - Format^Point Style. MEASURE . -

    *'h , .

    DIVIDE, , , B l o c k . AutoCAD , . , AutoCAD, . . 12.12 , - 20- .

    2 0 ' UTILITY EASEMENT-W ON EACH SIDE OF,LOT LINE (TYPICAL)

    2 0 8 . 5 b

    S 8 7 ' 1 6 ' 2 4 ' V /s H s H s H T

    2 1 0 . 2 2 '

    . 12,12. 20- . (Bill Maidment), Cattech, Inc.,, .

    12. 339

  • abl2-a.dwg, - Drawings -.

    . 1. abl2-a.dwg -,

    .

    2. , D (. 12.13) ZOOM Window.

    . 12.13. , D

    3. , - Format^Point Style. . Set Size Relative to Screen ( ) - 5%. .

    4. Draw^Point^Divide (1^ ). S e l e c t object to d i v i d e : 1, . 12.13. Enter the number of segments or [Block] : 3Measure (1^^). S e l e c t o b j e c t to measure: 2 (. . 12.13). Specify l e n g t h of segment or [Block] : 120

  • AutoCAD , , AutoCAD

    . , , , . - . AutoLISP. - .

    , cal> Expression: 3.953+6.8725

  • CAL

    CAL - . 3 '2-1/2", AutoCAD :E r r o r : i n v a l i d f e e t ' - i n c h e s " format (: '-").AutoCAD , "". , - . , ,AutoCAD 3*2" 1", 2" 3'2-1/2". , AutoCAD 23" 3", 8" 23-3/8".(3'2"+ 1"/2")+(23"+3"/8")61.875 3'-2" 38.0 ('=36" 2" 38"), 2" 3'?

    > Expression: 3' -2"38.0 , 3' . , AutoCAD - , . :> E x p r e s s i o n : ( 3 ' ) - 2 "

    3 4 . 0

    AutoCAD 3' (36") 2", 34".

    -

    CAL. , AutoCAD - , .

    , , - . . 12.14 , .

    /

    , 12.14.

    342 II.

  • , LINE (), S p e c i f y f i r s t p o i n t : CAL . :

    > Expression: (cen+cen)/2> Select ent i ty for CEN snap: Select ent i ty for CEN snap:

    AutoCAD - . CAL X Y, - ( ):

    > Expression: endend$P Select entity for END snap:>> Select entity for END snap:(-57.3212 -20.8632 0.0)

    DIST (), - . , D e l t a X D e l t a Y -, CAL:

    Command: '_dist First point: Specify second point:Distance = 61.000, Angle in XY Plane = 20, Angle from XY Plane = 0Delta X - 57.3212, Delta Y = 20.8632, Delta'Z = 0.0000

    , abs . 12.3 . , abs:

    >> Expres s ion : abs (endend) > S e l e c t e n t i t y for END snap:>> S e l e c t e n t i t y for END snap:61.0

    CAL From. , S p e c i f y f i r s t p o i n t : CAL - mid+[3,-2.51

  • . 12.3

    ()

    e x p l ()

    ^()

    sqrt(4ncm)

    () (), -

    ()

    () ,

    2()

    d2 ()

    pi 3,1415926

    ) . - ( ). AutoCAD , - -32768 +32767.

    CAL CAL . . 12.4 -

    . AutoCAD.

    ; 12.4. CAL

    ,

    p i 2

    p i 2

    p i 2 . d p i . 0.327, , p i 0.327

    , p i 2. t, p i . 0.45, , p i (0.45 p i 2) (.. )

    d i s t < p l , 2) p i 2

    d p i ( p , p i , p 2 ) , p i 2

    ang < p i , 2) , p i 2

    rad

    cur

    9

    vec (pi,

    vecl(pi

    pldipl,

    pit(pi,

    P2)

    ,p2)

    p2,d>

    p2,t)

    344 II.

  • . 12.4

    ang (v) v. - (end-end), -

    a n g ( a , p l , p 2 ) , p i , 2. ( .)

    i l l ( p l , p 2 , p 3 . : 4 ) p i 2, 4

    . - d e l t a d e l t a .

    abl2-a.dwg, - Drawings -.

    , . . c u r -, .

    . 1. a b l 2 - a . d w g -,

    .

    2. a b l 2 - 1 . dwg AutoCAD B i b l e .

    3. , D (. 12.15) ZOOM Window.

    4. . - 306 975,04 . - , CAL E x p r e s s i o n : 306975.04/144

  • next p o i n t or [Undo] : (Perpendicular) 5. . 12.16.

    7. .

    1

    . 12.15. D

    tdi*e . 1

    * 210.22*

    . 12.16. CAL, -,

    346 II.

  • AutoCAD . -

    , , , .

    LIST, DIST ID . .

    , . AutoCAD .

    12. 347

  • 1

    ... - ::

    . : . .

    .

    - , - ,

    . (annotation). AutoCAD . , - . , . . AutoCAD.

    , - , .. - Draw^Text^Single Line Text(1^^ ). - DTEXT (). , .. - . ( TEXT(), .) :

    Current text style: "STANDARD" Textheight: 0.2000Specify start point of text or [Justify/Style]: .Specify height : , - .Specify rotation angle of text : - , .

    Enter text: . .Enter text: , .

  • , . .

    J u s t i f y () . S t y l e() .

    . DTEXT - , . , .

    Respace BS, . - . \ S o f t w a r e \ c h a p i 3 \ R e s p a c e -. - i t ( T E X T ) i d t ( DTEXT) . \ S o f t w a r e \ c h a p i 3 \ i t . , 123, . \Software\Chapl3\123. ( , h t t p : / / h o m e . p a c i f i e r . c o m / ~ n e m i , - I d t . l s p.)

    DTEXT , - . .

    AutoCAD , . , Specify s t a r t p o i n t of t e x t or [ J u s t i f y / S t y l e ] : ( [/]:) .

    , - . L E A D E R QLEADER, - 14, " ".

    -

    . (insertion point). - , I n s e r t( ). , .

    . - , Specify s t a r t p o i n t of t e x t or [ J u s t i f y / S t y l e ] : - j

  • . Align , - , -

    . .

    F i t S p e c i f y h e i g h t: ( :). , . , . , . . 13.1 , - .

    J u s t i f y - . . 13.1. .

    . 13.1.

    Steps to grade

    S t e p s t o g r a d e

    S t e p s t o g r a d e

    . 13.1. ,

    , AutoCAD , - J u s t i f y .

    ,

    , -

    , . : - ( , ,, )

    , - . ,

    .

    , -

    -. : - ( , , , ) -

    i Garage M i d d l e C e n t e r , . : -

    ( , ,, )

    arage;

    Garage

    Go rag

    Garage

    Garage

    Garage :

    Garage >

    Garage'

    L e f t

    C e n t e r

    R i g h t

    M i d d l e

    Top L e f t

    Top C e n t e r

    Top R i g h t

    M i d d l e L e f t

    350 II.

  • . J3.I

    Garoge M i d d l e R i g h t - . ; -

    ( - , , , )

    A 9 V B o t t o m L e f t , . -

    , -

    Garage B o t t o m C e n t e r . 1

    : Garage,, B o t t o m R i g h t , -

    S p e c i f y s t a r t p o i n t of t e x t or [ J u s t i f y / S t y l e ] : - . ,

    ( ), - , .

    . 0.2 ,

    . . , - 1:96, , , - .

    , , 0,2 - 1:96, 19.2 (0.2x96). , , , 10:1, 0.02 . - . 13.2 5 , - 1:64, 5/64 .

    1

    . 13.2. - , 5

    13. 351

  • AutoCAD . - . 1/72 ;1 2.54 . , 12- 0.17 ( 4 ). Auto-CAD 0.2 , , , 14 ( 5 ). .( , , , .)

    DTEXT . -

    , . AutoCAD - obliqued {) ( rotated ), STYLE (), .

    . 13.3 , 315.

    . 13.3. , 315

    DTEXT , (. ). , () .

    , . 13.2, AutoCAD. TrueType ( Windows) PostScript.

    . 13.4 , , - .

    352 .

  • 13.2. AutoCAD

    {/)

    %% {/)

    %%d ()

    %% - ()

    %% {0}

    35.3 not 35.8 %%u35.3%%u not 35.8

    01.5 %%d.5

    + .002 %%.002

    . 13.4. - AutoCAD

    a b i 3 - a . d w g , - Drawings -.

    . DTEXT1. - .dwg -.

    2. - 1 . dwg AutoCAD Bible. -, . 13.5. (Endpoint), (Midpoint) ( I n t e r s e c t i o n ) .

    3. Draw^TextoSingle Line Text (^1^ ). :Current t e x t s t y l e : "ROMANS" Text h e i g h t : O'-4 1/2"Specify s t a r t point of t e x t or [ J u s t i f y / S t y l e ] : Justify Enter an option[Align/Fit/Center/Middle/Right/TL/TC/TR/ML/MC/MR/BL/BC/BR]:

    Specify bottom-center point of text : - , 1 (. . 13.5)Specify r o t a t i o n angle of t e x t : 2Enter t e x t : 2-0

  • . 13.5.

    Specify start point of text or [Justify/Style]: Justify Enter an option[Align/Fit/Center/Middle/Right/TL/TC/TR/ML/MC/MR/BL/BC/BR]: Middle

    Specify middle point: 3 ( - )

    Specify rotation angle of text : 0

  • . - TEXT, , (. 30, " - ", 33," ") AutoLISP (. 34, "AutoLISP Visual LISP", 35, " AutoLISP"). AutoCAD .

    A u t o C A D 2000 T E X T D T E X T .

    , . , 2000i, -

    ! TEXT, AutoCAD 2000. - t e x t , , , .

    , ,

    . . DDEDIT (). -

    Modify^Text (^). - S e l e c t an a n n o t a t i o n o b j e c t or [Undo]: ( []:). , , TEXT DTEXT, . AutoCAD EditText ( ). - , , . 13.7. , , -, , Windows -. , ,

    . 13.7. Edit Text

    , D D E D I T , . 2000i.

    !

    , DDEDIT ; .

    i - , Properties () -L__"_ . Properties Properties (. 13.8). , , , , , - , , , , . , - .

    13. 355

  • Properties eidiitocid bilile\183b.dwij Re... E3

    ColorLayerLinetypeLinetype scalePlot styleUneweigT*Hyperlinkrhickress

    Tent

    Contents

    style

    Justify

    Height

    Rotation

    Width factor

    Obliquing

    Text a l i m e n t X

    /Layer

    ByLayer

    WAS1 1/6REF8>S-I5,

    REVTXT

    Left

    S70,OO

    .750000

    .00

    *

    Texi

    Geoi

    akgnment Y

    akgnment Z

    imetry

    .ton X

    Positon 1

    H M i s c

    Upside down

    End-ward

    . 13.8, Properties ,

    (, ,

    ) , .

    S C A L E T E X T - . .

    !

    SCALETEXT .

    1. Modify^Object^Text^Scale (^^^ ).

    2. , .

    3. , Enter a base p o i n t opt ion for s c a l i n g [Exis t ing/Lef t/Center/Middle/Right/TL/TC/TR/ML/MR/BL/BC/BR]: - , , - . ( - , , -,

  • "): Scale factor ( ), -. Matchobject ( ) - . AutoCAD .

    5. Scale factor, Specify s c a l ef a c t o r or [Reference] : .

    6. - , Reference (). - AutoCAD Speci fy r e f e r e n c e l e n g t h : - , . Specify new l e n g t h : , - .

    Case4 0c , . \ S o f t w a r e \ c h a p l 3 \ C a s e 4 0c.

    JUSTIFYTEXT -

    .

    JUSTIFYTEXT , . -

    ! .

    JUSTIFYTEXT, Modify^Object^Text^Justify (^^^). , . Entera j u s t i f i c a t i o n o p t i o n [Left/Align/Fit/Center/Middle/Right/TL/TC/TR/MV/MC/MR/BL/BC/BR] : .

    - b . d w g , - Drawings -.

    . 1. -b.dwg -.

    2. - 2 .dwg AutoCAD Bible. - , . 13.9.

    3. 1/2" PIPING. Edit Text( ). 1/2 3/8. . AutoCAD . - .

    13. 357

  • . 13.9. . - (U.S. Army Corps of Engineers)

    4. Properties . - Quick Select Properties. Quick Select Text Object type ( ). Operator() Select All ( ) .AutoCAD .

    5. Properties L a y e r (). TEXT. C o l o r(). ByLayer (). - TEXT ByLayer. , .

    6. . . S. . , , . Mod-ify^Object^Text^Justify ( justifytext

  • , AutoCAD . AutoCAD

    , - (, ), , . , - ( : ).

    , , , ," , , ". , -

    ,

    ,

    ,

    .

    . - .

    :." ?\ AutoCAD , . shx, True Type,

    Windows. 32, " ", .

    , Format^Text Style ("=>

    ). STYLE TextStyle ( ) . 13.10.

    Text Style

    . 13.10- Text Style

    New Text Style ( ), - . 13.11, New () Text Style ( -). . - , 255 , -

    13. 359

  • New Text Style . AutoCAD - Text Style, - .

    . 13.11. New Text Style

    Font () Text Style ,

    . Font Name (). . True. AutoCAD; (shape file), .shp, .shx.

    - '^:\ A r c h f o n t , -. - \ S o f t w a r e \ C h a p l 3 \ A r c h f o n t .

    . Preview () - . . - - Preview (), -, .

    AutoCAD T r u e T y p e , dwg. True Type,

    AutoCAD.

    Font Style () -, , , , , , . True Type , AutoCAD .

    Height () . , .

    , - . 0 AutoCAD - TEXT DTEXT.

    Effects () , . / ( Width Factor)

    1. , , , - (. 13.12).

    = 1.5 B e a r i n g H o u s i n g

    = .eBearing Housing

    . 13.12. /

    360 II.

  • ( Oblique Angle) .

    , . , - , TrueType, .

    AutoCAD., , .. , . - . - . . 13.13 , - .

    =-10 B e a r i n g H o u s i n g

    = 10 Bearing Housing

    . 13. IS. -

    , ( - ) . . . .

    . 13,14, , , , -

    Apply() . Close .

    . -

    STYLE (), Text Style ( ). Rename (), Rename Text Style ( ) . 13.15. , New Text Style ( ).

    , Style Name( ) Text Style ( ) Delete (). AutoCAD . Yes (), - . , .

    13, 361

  • Rename Tex) Style

    -

    . 13.15. RenameText Style

    -b.dwg, - Drawings -.

    . 1. -b.dwg -.

    2. -2 .dwg AutoCAD Bible.

    3. Text Style, Format^Text Style. New () . - New Text Style Notes . - Font Name () romans.shx. Height () 1/16". Width Factor ( -) / 0.95. Oblique Angle ( ) 10. Apply (), -. Close ().

    4. DTEXT. Speci fy s t a r t p o i n t of t e x t or[ J u s t i f y / S t y l e ] : -. Speci f r o t a t i o n a n g l e of t e x t : - . E n t e r t e x t : Note: Not drawn to scale.(: .) . , .

    5. . , . 13.16. - , .

    . 13.16.

    362 //.

  • , Format^Text Style.

    Style Name. - , . Apply, Close. AutoCAD . .

    ,-**" , (, , ). -

    , /, , -. .1

    , Properties . AutoCAD - Properties. Text style - . , Auto-CAD .

    .

    TEXT DTEXT, AutoCAD Specify s t a r tp o i n t of t e x t or [ J u s t i f y / S t y l e ] :. Style . Enter s t y l e name or [?] : ( [?] ) AutoCAD .

    , . Auto-CAD Speci fy s t a r t p o i n t of t e x t or [ J u s t i f y / S t y l e ] :. , J u s t i f y () .

    , , - ? . AutoCAD E n t e r t e x t s t y l e (s) to l i s t : ( :). , Auto-CAD , Specify s t a r t p o i n t of t e x t or [ J u s t i f y / S t y l e ] :. :

    Text styles:Style name: "Notes" Font files: rornans . shx

    Height: O'-O 1/8" Width factor: 0.950000 Obliquing angle: -10Generation: Normal

    Style name: "ROMANS" Font files: C:\ACADWIN\FONTS\ROMANS.SHXHeight: O'-O 1/8" Width factor: 1.000000 Obliquing angle: 0Generation: Normal

    Style name: "SIMPLEX" Font files: simplex.shxHeight: O'-O 1/8" Width factor: 1.000000 Obliquing angle: 0Generation: Normal

    Style name: "STANDARD" Font files: txtHeight: O'-O 13/64" Width factor: 1.000000 Obliquing angle: 0Generation: Normal

    , Style - . J u s t i f y .

    13. 363

  • . - Formats-Text style. Style Name -

    Text Style ,% Close.

    (), Multiline Text Editor( ), . Properties Style.

    , " , , ",

    AutoCAD DesignCenter. - - .. . .

    1. AutoCAD DesignCenter . DesignCenter.

    2. , .

    3. "+".

    4. ( , - ) .

    5. .

    6. DesignCenter Close .

    '""'Hi&v abi3-3.dwg, - Results -. *

    . 1. abl3-3.dwg, , , -

    . , - 3 . dwg, - R e s u l t s , -.

    2. abl 3-4 .dwg AutoCAD Bible.

    3. Notes. Forrnat^Text Style. Text Style Style Name NOTES, - i t a l i c . s h x . Apply, Close.

    4. AutoCAD , .

    5. .

    364 II.

  • ,

    . , . - ( , ) , , . - .

    AutoCAD Word Windows . - , . - TrueType , , , .

    Multiline Text Editor| " , Multiline Text ( ) [_^_ Draw (). (). AutoCAD , :

    Current text style: ROMANS. Text height: 4 1/2"

    AutoCAD Specif f i r s t c o r n e r : ( :). , . '- Speci fy o p p o s i t e c o r n e r or [ H e i g h t / J u s t i f y / L i n e S p a c i n g / R o t a t i o n /Style/Width] : ( [// ///]:) . , . - ( ) Multiline TextEditor ( ), -. . 13.17 Multiline Text Editor.

    multiline Text Editoi,'Character j Piopertie* | Line | FndHeptoce |

    )' 3 J02500 _-| : 5!J J j

    UltMl 1 ,i]-r.

    . 13.17. Character Multiline Text Editor

    . Multiline Text Editor , AutoCAD , - . , , AutoCAD - , .. . - , AutoCAD .

    AutoCAD ,

    , .

    13. 365

  • , - DTEXT/TEXT.

    -: , - Stack/Unstack Character. , - AutoCAD 2002.

    , Multiline TextEditor, Character () - .

    3/5

    3#5

    35

    . 13.18. -

    1. ( , - ).

    2. (/), , (. 13.18).

    3. (#), - , (. . 13.18).

    4. (), - , , - (. . 13.18).

    5. .

    6. ( , ). AutoCAD - AutoStack Properties (. 13.19).

    7. . AutoCAD - .

    AutoStack Properties .

    Enable AutoStacking ( AutoStacking) , .

    Remove leading blank ( ) , - .

    Specify how "x/y" should stack - - (/). - - (# ) -. Convert itto diagonal fraction - , Convert it to horizontal fraction .

    Don't show this dia-log again; always use these settings , AutoStack Properties - ]3.19 , Properties

    AutoSiack Properties00 you w ^ M automata* stack (he te*l/&* st you type?

    Specify hcm"*.. thoid tuck*

    Convert * lo a diagonal fraction

    I* Convert rt(Qe'jj(wrllal fractal

    Oonl ihowthsdHslogagMValway use

    ewtfeet

    "OK ( fjneet

    AutoStack

    366 //.

  • AutoCAD , Multiline Text Editor.

    OK AutoCAD . - Cancel, , .

    AutoStack , - . - , , - , .

    . - Multiline Text Editor - Properties (). Stack Proper-ties .

    Text () .

    Style () . ( . 13.18.)

    Position () , , - .

    Size () , . ( .)

    Character

    Character () . .

    Font () .

    Height () .

    Bold () -. , - .

    Italic () . , .

    Underline () .

    Undo () , , - .

    Stack/Unstack (/) ( ). , . (/), (#) - (). - AutoStack, . - , , .

    Text Color ( ) . - ByLayer .

    Symbol () -, twoc-MUHvc, . Others(), Windows Character Map .

    13. 367

  • ( ), , 2.

    Stack/Unstack Character. , '$*. , , , .. 2,

    .

    Import Text ( ) Open(), ( . t x t ) RichText Formal ( . r t f ) , . 16 . , .AutoCAD Multiline Text Editor. - .

    Rich Text Format . , .

    Properties , , -

    , Properties (), . 13.20. - . , , . , . - , . .

    'Modify cited prapertw

    . 13.20. Properties Multiline Text Editor

    Line Spacing Line Spacing

    . , -, .

    Exactly () At least ( ). , AutoCAD . - . At least , - .

    368 II.

  • , . Single( ), 1.5 Lines ( ) Double ( ). Auto-CAD , -, . . . . ( - ) .

    Find/Replace , Find/Replace

    (/). . , , (/), - Match Case ( ). -, Whole Words ( ). , and, Whole Words, - sand random.

    , DDEDIT (), -

    Modify^Object1^ TextEdit. AutoCAD S e l e c tan a n n o t a t i o n o b j e c t or [Undo] : ( []:). , . , Multiline Text Editor.

    ^,"^ , TEXT DTEXT, AutoCAD Edit Text (. . 13.7).

    . - .

    .

    , , - ( ).

    , Charac-ter () Properties ().

    Character () - , . Properties () , . Multiline Text Editor :

    ;

    , ( , );

    13. 369

  • ( ).

    , , . .

    , , : Undo, Cut, Copy, Paste Select All.

    , . Modify Text ( ), -

    Properties () . Properties , (, ..).

    , , Character ()

    Multiline Text Editor. .

    , . Windows Explorer . ( . t x t ) Rich Text Format ( . r t f ) . Windows Explorer , AutoCAD. . Windows Explorer .

    (Clipboard) Windows. , () . , - AutoCAD Windows. Paste () . Multiline TextEditor, . Paste () ( ).

    I

    27," ".

    - c . d w g , - D r a w i n g s -.

    . 1. -c.dwg -.

    2. - 5 . dwg AutoCAD Bib le . , . 13.21.

    3. Multiline Text ( ) Draw (). 1 2(. . 13.21). Multiline Text Editor. Font Height( ) 12.5. :

    370 //.

  • Containing 108.33 acres including 5.97 acres existing R.O.W. and4.56 acres proposed R.O.W. 108,33 , 5,97 - 4, 56 .

    4. 108.33 Underline. Properties. Justification () - Middle Left ( ). . AutoCAD .

    5. Windows Explorer ( Start^Programs^Windows Explorer(^^^)). - a b l 3 . t x t . Windows Explorer , a b l 3 . t x t 3 (. . 13.21). a b l 3 . t x t Windows Explorer 3.

    6. ModifyoObject^Text^Edit , - . Multiline TextEditor. Properties 500. . Enter - .

    7. ZOOM Window, . , %%d . - AutoCAD . , !

    8. ZOOM Previous , - . .

    . 13.21. ' . (Bill Maidment), Caltech, Inc., (. )

    13. 371

  • ,

    . , TrueType, , . , , - . - .

    , K I D E T E X T -

    , : - , . , ,

    , .. H I D E , on, . o f f , , , . { - H I D E 21, " ".)

    QTEXT () , -

    , (. 13.22). - , ( - , ; AutoCAD. . .). QTEXT, qtext

  • AutoCAD AutoCAD , TrueType, , ,

    , . t x t . shx. . AutoCAD, . AutoCAD - , . , , , - .

    , AutoCAD . , , . - , Preferences(), AutoCAD Tools^Options (^). Files () " + " Text Editor,Dictionary, and Font File Names ( , ). - Alternate Font File ( ) . - s i m p l e x . s h x .

    , AutoCAD , Font Mapping File ( ). \ s u p p o r t \ a c a d . fmp. : -_;__. . Arial Black simplex, : Ariblfc. t t f ; s implex, shx.

    Fonts, Windows, TrueType, .

    ^ ^ # * AutoCAD - - , , Font Mapping File,

    I , .

    (

    , ). . , (. 14, " ").

    MIRRTEXT -

    . . ( -). MIRRTEXT .

    13. 373

  • , - , MIRRTEXT-j . Newv a l u e for MIRRTEXT : ( MIRRTEXT :) 0 MIRRTEXT . - , , -, .

    - d . d w g , - Drawings -.

    . 1. - d . dwg -.

    2. abl3-6.dwg AutoCAD Bib le . - , . 13.23. - ( ORTHO()) ( OSNAP ()), (Endpoint), (Midpoint) ( I n t e r s e c t i o n ) .

    3. qtextBRN

    BLK ,

    2

    I

    - 3 1POWER

    VALVE

    SENSOR

    GROUND

    ' 1 1

    Puc. 13.23.

    374 II.

  • 9. -, . 5. AutoCAD , -, . 13.24.

    10. .

    . 13.24. - MIRRTEXT 0

    RLD

    SRN

    BL.KVA.L'

    GP.0

    M.! F

    PEL1

    ! 4

    FIND () ,

    , - , .

    FIND Edit^>Find. - Find and Replace ( ), . 13.25.

    |Find and Replace

    Fjnd led tiling earch fiOW

    Se-stch fesuRs:

    $4thAVE N.W. EMSTIHGEHS 66*

    Puc. 13.25. Find and Replace -

    .

    1. Find text string ( ) , . - .

    2. , Replacewith ( ). , - .

    13. 375

  • 3. , Search in ( ). FIND , Current selection ( ). Entire Drawing. - : Select objects AutoCAD - Find and Replace . . , - , .

    4. Options. . ( Match case) ( Find whole words only).

    5. Find Next - .

    6. Replace with Replace (). Replace All ( ) .

    7. Search in Current selection, .. , Select All ( ) . - AutoCAD , . -. , , ( - , ). .

    8. Zoom () , . , - .

    9. , Close.

    SPELL ().

    AutoCAD , . - Tools^Spelling(^), Check Spelling ( ), - . 13.26.

    AutoCAD . , all

  • !

    , - . 18, " ".

    Ignore () , .

    Ignore All ( ) , - .

    Change () -, .

    Change All ( ) .

    Add () , . .

    Lookup () Sugges-tion () . , .

    AutoCAD , S p e l l i n g Check Complete ( ).

    . -

    , Check Spelling ( ) Change Dictionaries ( ) Change Dic-tionaries ( ), . 13.27.

    , AutoCAD. , Auto-CAD. , American E n g l i s h (). B r i t i s h E n g l i s h ( ), French with unaccentedc a p i t a l s ( -) French with a c c e n t e d c a p i t a l s( ).

    , Add() Check Spelling, , , , , - AutoCAD, . , CustomDictionary words ( -) Change Dictionaries.

    , 13.27, Change Dictionaries

    Chanqe Dictionaries

    JD \PROGRAM FILES\aUTOCAD'2002\!u

    AutoCADAutoCDMftutudeskAutoEDM

    3

    13. 377

  • , - , Check Spelling.

    AutoCAD S p e l l i n g Check Complete.-.?'' :

    , S P E L L . .

    , - . AutoCAD

    AutoCAD s u p p o r t v O sample . cus.

    sample.cus - Notepadile Edit Search HelpfICADncisfiutoCfiDftutoCDMAutodeskfiUtoEOMButoFlixAutoLatheflutoLISPflutoShadeflutoSketctifiutoSolidflutoSur-fRutoUision

    - , Custom Dictionary words ( ) Add (). - .

    . 13.28 Notepad ( - Windows) sample, cus. , AutoCAD - , , -, AuloLISP, .. .

    - .28- sample, cus Notepad, -

    . , AutoCAD - . - Microsoft Word, .

    1. Microsoft Word. , - Start^Find (^) Find (). . d i e . ( custom, d ie) C:\Program Files\MSOf f ice\Of f ice , . AutoCAD, - Notepad .

    2. Windows Explorer, s u p p o r t AutoCAD. , - , () , .

    3. custom, d i e suppor t AutoCAD . cus. Windows , -. Yes ().

    4. Change Dictionaries. Custom Dictionary( ) Browse () .

    5. Apply & Close, Check Spelling, Cancel ()- .

    378 II.

  • , , .

    AutoCAD : DTEXT (), TEXT () (). DTEXT () TEXT () , () .

    , . AutoCAD - . - . Rich Text Format. . .

    , .

    13. 379

  • ... AutoCAD'

    -

    - '

    AutoCAD.

    - . AutoCAD - . , , ( ), AutoCAD 1.

    AutoCAD

    , . -. , , , .

    17, " ", -, - .

    ,

    . -

    - - . , , - , . . .

  • , . . 14.1 .

    4 , 7 5 0 0

    I -

    . 14.1.

    .

    . . . - .

    ^ ^ * -Tia . ,

    , . . , - . .

    . . - , ..

    . .

    . . (), .

    , , , , - .

    . , - 18, " ". - 1 , , . .

    . , , . ,AutoCAD . - , .

    . - , -

    14. 381

  • , , - . .

    AutoCAD 2002 - . AutoCAD .

    ! . ( - .)

    , , .

    1. . , . - . , - ( ), , .

    ( - ), -

    . , v - 1 E l e c t r i c a l , ,

    D i m - e l e c , E l e c t r i c a l .

    2. , AutoCAD, - - DIMASSOC. dimassoc , , 2Drafting Settings(^ ) . (Endpoint) (Intersection). , (Center) (Quadrant). , OSNAP .

    5. . ( - .)

    6. , , . .

    382 .

  • AutoCAD Dimension (). - Dimension (), Dimension (). , . 14.2.

    Linear Diameter Continue Dimension Edit

    Ordinate

    ID mensioit

    Quick Tolerance Update Dimension Style

    Aligned Angular Quick Leader Dim Style Control

    Radius Baseline Center Mark

    Dimension Text Edit

    . 14.2. Dimension

    (

    - . , -, . , , 3, " AutoCAD".

    , , . , - , dimlinear:( :). - , , .

    14. 383

  • - . , ,

    , , , . - ,

    .

    , , - . Specify second e x t e n s i o n l i n eo r i g i n : ( :) . .

    , Specify f i r s t e x t e n s i o nl i n e o r i g i n or < s e l e c t o b j e c t > : . AutoCAD S e l e c t o b j e c t to d imension : ( :). .

    Specify dimension l i n e l o c a t i o n or [Mtext/Text/A n g l e / H o r i z o n t a l / V e r t i c a l / R o t a t e d ] : ( [/////]:) . , , - (. 14.3). , - (, @0,0.5, - 0.5 ). , - .

    . 14.3.

    Object snap tracking () - . , , , - . Speci fy f i r s t e x t e n s i o n l i n eo r i g i n or < s e l e c t o b j e c t > : , . . AutoCAD .

    384 //.

  • abi4-a.dwg, - Drawings -.

    . 1. abl4-a.dwg -.

    2. 4 - 1 . dwg AutoCAD Bible . , - . 14.4. -. (Endpoint), (Midpoint) (Intersection). Dim.

    B E D R D D M

    N

    . 14.4.

    3. Dimension, Dimension. Close. (. . 14.4).

    4. Dimension Linear Dimension. Specify f i r s t ex tens ion l i n e o r i g i n or < s e l e c t o b j e c t > : 1 (. . 14.4). Specify second extensionl i n e o r i g i n : 2. Specify dimensionl i n e l o c a t i o n o r [ M t e x t / T e x t / A n g l e / H o r i z o n t a l / V e r t i c a l /R o t a t e d ] : , - . .

    14. 385

  • 5. DIMLINEAR (). Specify f i r s t extension l i n e o r i g i n or< s e l e c t ob ject>: . Specify second extens ion l i n eo r i g i n : 3 (). AutoCAD Specifydimension l i n e l o c a t i o n or [Mtext/Text/Angle/Horizontal/Vert ical/Rotated] : , - . .

    6. . , . 14.5.

    B E D R D D M

    11 1/2"

    . 14.5. ,

    DIMLINEAR -

    .

    MText MText () , -

    AutoCAD, - ( , ). - Specify dimension l i n e l o c a t i o n or [Mtext/Text/Angle/Horizontal/Ver t ica l/Rota ted] : ( [/// -//]:) m

  • , AutoCAD, - . , , . .

    . 14.6. MultilineText Editor

    , , (, ) ( ).

    , (, ).

    jinn"* , -Tfa

    , - . -, , Dim A.

    Text T e x t () , Multi-

    line Text Editor. .

    Angle , .

    A n g l e(). Angle, AutoCAD S p e c i f y a n g l e of d i m e n s i o n t e x t : ( :). , .

    Horizontal/Vertical DIMLINEAR () , -

    , , . . , - , , - (. 14.7). - - , H o r i z o n t a l / V e r t i c a l (/).

    14. 387

  • . 14.7. - , - . - , Y

    Rotated , -

    , . , . 14.7 , - , - , . , .

    , - DIMLINEAR, - - R o t a t e d (). Speci fy a n g l e of dimension l i n e :( :) - ( , ). AutoCAD - .

    , 14.8 - . 104.5, 135. , AutoCAD , - ( . 14.8), .

    abi4-b.dwg, - Drawings -.

    . 14.8. - -

    388 II.

  • . DIMLINEAR1. abl4-b.dwg -.

    2. 4-2 . dwg AutoCAD Bible . (. 14.9). ( OSNAP () ). (Endpoint) (Intersection). Dimension (), - - () Dimen-sion. Close ().

    . 14.9.

    3. Dimension () Linear

    ( ). :

    Specify first extension line origin or :

  • 4. .

    5. DIMLINEAR. :

    Specify f i r s t extension line origin or :

  • . - , - , . -, , , - . . 14.11 - .

    . 14.11.

    ! I;'.11;

    /

    .

    , Aligned Dimension ( ) Dimension (). -

    DIMALIGNED (). AutoCAD Speci fy f i r s te x t e n s i o n l i n e o r i g i n or < s e l e c t o b j e c t > : ( :). -, .

    . 14.11 , . , - .

    AutoCAD S p e c i f y d imens ion l i n e l o c a t i o n or[Mtext/Text/Angle] : ( [//]:). . . - , - (, @2

  • 2. abl4-3.dwg AutoCAD Bible . , (. 14.12). ( OSNAP () -). (Endpoint) (Intersection). Dimension (), - Dimension. Close.

    . 14.12.

    3. Dimension Aligned Dimension. :

    Specify first extension line origin or : 1 (. . 14.12)Specify second extension line origin: 2 (.. 14.12)Specify dimension line location or [Mtext/Text/Angle]: MText Multiline Text Editor

    ' . Specify dimension line location or [Mtext/Text/Angle]:

    4. . , . 14.13.

    332 II.

  • . 14.13.

    , . AutoCAD ; (baseline) - (continue).

    (baseline dimension) -, . . ..

    (continued dimension) . .. - .

    . 14.14 . , - . AutoCAD 2000 Quick Dimension, . .

    14. 393

  • V

    . 14.14.

    ^ > , -& , . ( .) Dimension Baseline Dimension (). AutoCAD s p e c i f ya second e x t e n s i o n l i n e o r i g i n or [Undo/Select] < S e l e c t > : ( - [/] :).

    , , AutoCAD . , AutoCAD .

    ( ) - , . AutoCAD S e l e c t basedimension: ( :). . ( , ) , - . AutoCAD , , , AutoCAD .

    AutoCAD . , - . : .

    , , AutoCAD - . - , AutoCAD .

    394 II.

  • , . AutoCAD S e l e c t c o n t i n u e d d i m e n s i o n : ( :). . - , . - AutoCAD . , , AutoCAD .

    AutoCAD . , . : - (Endpoint}, 1 (. . 14.15)Specify second extension line origin: 3 , , , . , 1, . endpoint: 1'-6" : 4 "" AutoCAD. 1 , -

    14. 395

  • . AutoCAD . , AutoCAD - , .

    6. AutoCAD S p e c i f y a second e x t e n s i o n l i n e o r i g i nor [ U n d o / S e l e c t ] < S e l e c t > : . 2(. . 14.15). AutoCAD . - .

    7. Linear Dimension Dimension. :

    Specify first extension line origin or : - (Endpoint), 5 (. . 14.15)Specify second extension line origin: 7 , , , . , 5. endpoint: 4 '0" : ( ) 6 (. . 14.15). - .

    9. . , . 14.16.

    , .

    , , . . AutoCAD .

    ,

    , " " -. , - . ( ) - () , . 14.17.

    Dimension Center Mark ( -). S e l e c t a r c or c i r c l e : ( ;) - , . AutoCAD .

    396 //.

  • . 14.16.

    . 14.17. - -

    , Radius Di-mension () dimension. AutoCAD Select arc or c i r c l e : . . , . Specify dimension l i n e locat ion or [Mtex1-/Text/Angle] : ( -

    14. 397

  • [//]:) , . AutoCAD R , (. 14.18).

    R5/1S

    . 14.18. ( , ) ( , )

    MText, Text, Angle , .

    , Diameter Dimen-sion () Dimension. AutoCAD S e l e c t a r cor c i r c l e : . . S p e c i f y d i m e n s i o n l i n el o c a t i o n or [ M t e x t / T e x t / A n g l e ] : , . AutoCAD ( : 0) , (. 14.19).

    /

    . 14.19.

    MText, Text, Angle , .

    AutoCAD . -

    , , , - . . 14.20 , .

    398 If.

  • . 14.20. . ( . Reffern), Bethlehem Corporation,,

    *?> , Angular Dimension? ( ) Dimension. AutoCAD S e l e c t a r c , c i r c l e , l i n e , or : ( , , - :). AutoCAD , .

    , AutoCAD , . - .

    , AutoCAD , .

    , AutoCAD , , , - . AutoCAD Specifysecond a n g l e e n d p o i n t : ( :). .

    , AutoCAD - . AutoCAD . , AutoCAD - .

    , , AutoCAD S p e c i f y d imens iona r c l i n e l o c a t i o n or [Mtext/Text/Angle] :. - ( , , - ).

    MText, Text, Angle , .

    14. 399

  • , , : - 180, . , 180, ;, 180, . AutoCAD , 180 . :

    ? D I M A N G U L A R(). AutoCAD S e l e c t a r c , c i r c l e , l i n e , o r< s p e c i f y v e r t e x > : .

    , . S p e c i f y d i m e n s i o n a r c l i n e l o c a t i o n o r [ M t e x t / T e x t / A n g l e ] : , . ( , , .)

    , ( !). AutoCAD . AutoCAD S p e c i f y d i m e n s i o n a r c l i n e l o c a t i o n o r [ M t e x t / T e x t / A n g l e ] : , .

    , . S p e c i f y d i m e n s i o n a r c l i n e l o c a t i o n o r [ M t e x t / T e x t / A n g l e ] : , .

    , .

    abl4-c.dwg, - Drawings -.

    . ,

    1. 4 - . dwg -.

    2. abl4-5.dwg AutoCAD Bible . (. 14.21). ( OSNAP () ). (Endpoint), (Intersection) (Center). - Dimension, - Dimension. Close.

    400 II.

  • .",

    . 14.21. -

    3. Dimension Center Mark ( ). S e l e c t a r c or c i r c l e :

    . .

    4. Dimension Diameter Di-mension (). S e l e c t a r c or c i r c l e : - 1 (. . 14.21). Specify dimension l i n e l o c a t i o nor [Mtext/Text/Angle] : .

    5. Dimension Radius Dimension(). Se lect a rc or c i r c l e : 2(. . 14.21). Specify dimension l i n e l o c a t i o n or [Mtext/Text/Angle] : . . , .

    6. Dimension Angular Dimen-sion (). :

    Se lect a r c , c i r c l e , l i n e , or :

  • arc l i n e l o c a t i o n or [Mtext/Text/Angle] : - .

    9, . , . 14.22.

    . 14.22. - , , -

    .

    (X, Y) ( 0,0), , . . 14.23 - .

    ( 0,0), Tools^Move UCS ( => ). , . ( ), View^Display^UCS Icon^Origin (^^1* ). , On (). - ( 0,0).

    , Qrdinate Dimen-L*?f:i S | o n ( ) Dimension. s p e c i f yf e a t u r e l o c a t i o n : ( :) , . .

    S p e c i f y l e a d e r e n d p o i n t or [Xdatum/Ydatum/Mtext/Text/Angle ] : ( [X /Y -///]:) . , , AutoCAD , X Y. , , -. , X , Y .

    402 II.

  • FIAT BLANK WTOUT. 14.23. -

    . - , . , X, Y; - .

    Multiline Text Editor , MText. Text.

    abl4-d.dwg, - Drawings -.

    . 1. 4-d.dwg -.

    2. abl4-6.dwg AutoCAD Bible . , . 14.24. , 0.25 . Dimension, Dimension. Close.

    14. 403

  • . 14.24.

    3. AutoCAD Tools^Move UCS (1^ ). - O r i g i n p o i n t < 0 , 0 , 0 > : ( :) 1 (. . 14.24).

    4. Ordinate Dimension ( ) - Dimension. S p e c i f y f e a t u r e l o c a t i o n :( :) 1 (. . 14.24). S p e c i f yl e a d e r e n d p o i n t or [Xdatum/Ydatum/Mtext/Text/Angle] : - 0.5 1, . 14.25. ( . , - .)

    . 14.25. :

    5. DIMORDINATE, . Specify f e a t u r e l o c a t i o n : 1 (. . 14.24). Specify l e a d e r endpoint or [Xdatum/Ydatum/Mtext/Text/Angle]: 0.5 1.

    6. , . 14.25.

    7. .

    404 II.

  • -- (leader) , . -

    . -, () . - - , .. , AutoCAD. - - . 14.26.

    BURR THIS SIDE

    .125 R. TYP.

    . 14.26. -,

    AutoCAD 2000 QLEADER, - , . , - QLEADER, Leader Settings ( ).

    -, Quick Leader () ESii Dimension. Specify f i r s t l e a d e r p o i n t , or[ S e t t i n g s ] < S e t t i n g s > : ( []:) . - Settings () . AutoCAD Leader Settings.

    . 14.27 Leader Settings ( ), -

    Annotation (). -, . - . - - QLEADER.

    Annotation Annotation -

    , . Annotation Type ( -) .

    MText, .. - .

    Copy an Object ( ), -- QLEADER , , .

    14. 405

  • MLeailer Settings

    . 74.27. Annotation Leader Settings

    Tolerance (), QLEADER Tolerance (), - , . ( - Tolerance, .)

    Block Reference ( ), - QLEADER - ( , ). , - .

    None (), AutoCAD .

    MText, - Mtext options - . .

    Prompt for width ( ), QLEADER - . .

    Always left justify ( ). QLEADER - , .

    Frame text ( ). .

    Annotation Reuse ( -) ( Reuse Next). , , AutoCAD ReuseCurrent ( ).

    Leader Line & Arrow Leader Settings . 14.28.

    .

    406 II.

  • .41 - .

    " .* ' : \: -

    * \

    ^ ri-mi

    Puc. 14.28. Leader Line & Arrow - Leader Settings

    Leader Line ( ) ( Straight), ( Spline). Number of points , QLEADER Specify next p o i n t : . Maximum . 2.

    Arrowhead () . .

    , Angle Constraints( ), . , - -. -, Any angle ( ).

    Attachment Leader Settings . 14.29.

    - .

    Puc. 14.29. Attachment LeaderSettings

    14. 407

  • Attachment . , . , -. , .. .

    , -, . . , .. - .

    ( , ).

    Top of top line ( ). (.. ).

    Middle of top line ( ). - .

    Middle of multiline text ( ). - .

    Middle of bottom line ( ). - .

    Bottom of bottom line ( ). .

    Leader Settings, . AutoCAD QLEADER.

    , QLEADER Quick Leader -

    Dimension, Specify f i r s t l e a d e r p o i n t , or[ S e t t i n g s ] < S e t t i n g s > : . . Settings, Leader Settings AutoCAD . - , - ( ). .

    AutoCAD Speci fy next p o i n t : . , - Leader Line & Arrow LeaderSettings. . - .

    Annotation Prompt for width, QLEADER - Specify t e x t width : ( .:). , AutoCAD , - . .

    E n t e r f i r s t l i n e of a n n o t a t i o n t e x t :( :) .

    , - AutoCAD. - . QLEADER E n t e r next l i n e of a n n o t a t i o n t e x t : ( -

    408 //.

  • :), , . , , .

    , Multiline Text Editor. - ( ), OK AutoCAD .

    ab!4-e.dwg, - Drawings -.

    . 1. 4 - . dwg -.

    2. abl4-7.dwg AutoCAD Bible. , . 14.30. Dimension, Dimension. - Close. (OSNAP ), .

    I/IB R

    3JM 3 17/(MR .Did. B41S

    . 14.30.

    3. Dimension QuickLeader (). Specify f i r s t l e a d e r p o i n t , or[Set t ings ] : Settings() . Attachment - Middle of multiline text. .

    4. :

    14, 409

  • Specify first point: 1 {. . 14.30)Specify next point: 2Specify next point: Specify text width : 2
  • /tti/JB

    . - . , Quick Dimension ,

    Quick Dimension .

    || 1. Quick Dimension Dimension.

    2. S e l e c t geometry to dimension : ( .) , . , . - - ,

  • : Radius

    Specify dimension line position, or[Continuous/Staggered/Baseline/Ordinate/Radius/Diameter/datumPoint/Edit]

    : 80

    4. Quick Dimension .

    5. QDIM. :

    Select geometry to dimension: 3

    Select geometry to dimension: 4

    Select geometry to dimension:

    5

    Select geometry to dimension:

    6

    Select geometry to dimension: 7

    Select geometry to dimension:

  • 1/1S fi /11

    OCR .75DA

    . 14.34. , -

    , , -

    .. - : , . , .

    , AutoCAD 2002, -

    . , AutoCAD, - .

    AutoCAD 2002. AutoCAD -

    1 - , ! , .

    , DIMASSOC. .

    0, . , - - .

    14. 413

  • 1, -, . - .

    2, . , - .

    DIMREASSOCIATE

    DIMREASSOCIATE. AutoCAD 2002 , . , DIMREASSOCIATE , . , , - .

    DIMREASSOCIATE .

    1. Dimension=*Reassociate Dimensions (=> - ).

    2. S e l e c t o b j e c t s : , - . , .

    3. , ., Specify f i r s t ex tens ionl i n e o r i g i n or [Select ob jec t ] :. - , (. 14.35). - , .. , . , , , .

    FUT BLANK LAYOUT

    . 14.35. AutoCAD -

    -, . , , 'redraw

  • 4. ( , - . 14.35, ), , - Select Object ( - Select Object). , -, , .

    5. , -, AutoCAD .

    , . -, , Endpoint ,

    1 , , - . , -, , , -, . , . - , .

    DIMDISASSOCIATE ,

    , DIMDISASSOCIATE, -. , .

    #"* , - ' .

    , .

    DIMREGEN DIMREGEN -

    .

    , .

    , , - AutoCAD.

    , - , .

    DIMEDITW&- DIMEDIT () .iL_i , . Dimension Edit ( ) Dimension. AutoCAD E n t e r t y p e of d i m e n s i o n e d i t i n g [Home/N e w / R o t a t e / O b l i q u e ] : ( [///]:). ,

    (). , .

    14. 415

  • New (). . AutoCAD - Multiline Text Editor ( ) - ( ) , . - , TYP (), .

    R o t a t e (). . .

    Oblique (), . , - , . - , .

    Oblique Dimension , obl ique - D I M E D I T .

    , DIMEDIT . , .

    DIMEDIT, -, .

    DIMTEDIT DIMTEDIT () -. .:'" . , Dimension Text Edit () Dimension. , , -. .

    AutoCAD S e l e c t dimension: ( :). , .

    Specify new l o c a t i o n for dimension t e x t or [Left/Right/Center/Home/Angle] : ( [////]:) -. .

    Left (). , - .

    Right (). , .

    Center (). , .

    (). ( ).

    Angle (). . R o t a t e () DIMEDIT ().

    abi4-g.dwg, - Drawings -.

    476 II.

  • . DIMEDIT DIMTEDIT

    1. 4 - . dwg -.

    2. ab l4-9 .dwg AutoCAD B i b l e . - , . . 14.36. Dimension, - - Dimension. - Close.

    . 14.36.

    , 1 . 14.36, , 1 4 . 4 1 . , Dimension Edit Dimension. Entertype of dimension e d i t i n g [Home/New/Rotate/Oblique] : New () #. Multiline Text Editor (). ( -), . S e l e c t o b j e c t s : , 1. , ( ). AutoCAD , .

    , 2 . 14.36, , . Dimension Text Edit

    14. 417

  • Dimension. S e l e c t Dimension: , 2. Specify new l o c a t i o n fordimension t e x t or [Left/Right/Center/Home/Angle]: Right ()
  • Quick Dimension

    Quick Dimension, , : QDIM . , AutoCAD "" , - (. 14.38).

    . 14.38. QDIM AutoCAD - " " , -

    QDIM .

    , .

    , .

    .

    .

    !

    , QDIM . , , -

    ... ' ] / , . , , - AutoCAD "".

    QDIM .

    1. Dimension Quick Dimension.

    2. S e l e c t geometry to d imens ion: ( :) , - .

    3. Speci fy dimension l i n e p o s i t i o n , or[ C o n t i n u o u s / S t a g g e r e d / B a s e l i n e / O r d i n a t e / R a d i u s / D i a m e t e r /datumPoint/ Edi t ] : - Edit () . - , , "".

    14. 419

  • 4. I n d i c a t e d i m e n s i o n p o i n t to remove, or[Add/eXit] : ( , , [/] .) .

    , . AutoCAD - -, , .

    Add () . . - .

    , - Exit () QDIM.

    5. Specify dimension l i n e p o s i t i o n , or[ C o n t i n u o u s / S t a g g e r e d / B a s e l i n e / O r d i n a t e / R a d i u s / D i a m e t e r / d a t u r nP o i n t / E d i t ] : , .

    6. . - , .

    7. , .

    8. AutoCAD .

    . , , .

    , . , - . < S t r e t c h to point>/Base point/Copy/Undo/eXit:(/ ///:). . , .

    . , , . .

    - . , -

    , .

    . 14.39 .

    AutoCAD.

    , .

    420 II.

  • AC UNITS

    26'-0 3/4*-]

    CHURCH BUILDING

    ()

    83'-2 3/4'

    CONCRETE RAMP

    . 14.39. . (Bill Maidment), Caltech,Inc., (. )

    , .AutoCAD , . - STRETCH ().

    , , STRETCH. , . - . Secondp o i n t of d i s p l a c e m e n t : ( :) ( @) . AutoCAD , , . 14.40 , - . , . - , . - , .

    abi4-h.dwg, - Drawings -.

    . DDEDIT, DDMODIFY 1. abl4-h.dwg -.

    2. abl4-10.dwg AutoCAD Bible. , . 14.41. , Dimension.

    3. Ht . Modify ObjectsTextEdit. S e l e c t an a n n o t a t i o n o b j e c t or [Undo] : , 1 . 14.41. Multiline Text Editor . . AutoCAD . - DDEDIT.

    14. 421

  • 7'-9-

    . 14.40.

    4. , . 14.41 2, , . Quick Dimension Dimension. Edit . I n d i c a t e dimension p o i n t to remove,or [Add/eXit] : ( "") . Exit () . Specify dimension l i n e p o s i t i o n , o r [Cont inuous/Staggered/

    422 II.

  • Baseline/Ordinate/Radius/Diameter/datumPoint/Edit] : , . ( .)

    0250 / \-1125

    0,250

    . 14.41.

    5. 1. . - "" .

    6. Stretch () Modify (). - ;

    Select objects: 3Specify opposite point : 49 foundSelect o b j e c t s : ^Specify base point or displacement: O,-.25

  • AutoCAD

    . -, , . , - . .

    . - .

    424 II.

  • 1

    14, " -", -

    , . , , - .

    , ,

    . , - , . .

    , , AutoCAD - .

    Dimension Style ( ) - Dimension (), Dimension Style Manager ( - ), . 15.1. - , Current () STANDARD (), , .

    Dimension Style Manager - -. - .

    ": ... * .

    ' > ,. ., * v l

    ._ i >i"( '""'| - - *"". "'"

  • \F-IDiinnnsiun Style MaiidiiZ'rutyie 5*

    Preview d Stwtdvd

    I fl.O

    55

    I -, : ) "E07 ; 0vee.de..

    . /5.7. Dimension Style Manager

    STANDARD, , . , , .

    , , New () - Create New Dimension Style ( ), - . 15.2. Name () , Start With ( ) , .

    1

  • Name ( ) , , - , . - ( , , ).

    , Continue (). Dimension Style Manager -

    . Styles . - , . .

    Continue Create New Dimension StyleAutoCAD New Dimension Style (. 15.3).

    New Dimension Style: Aich

    i^y \'-^ -''^

    i i i- -: J - . ,; t*ed I Closed 'died01800 - . -. - ' - . . . - ,

    Pwc. /5.5. Lines and Arrows NewDimension Style

    .

    Lines and Arrows ( ) , -, .

    Text () .

    Fit () - . , - .

    Primary Units ( ) - .

    15. 427

  • Alternate Units ( ) . , - ( , , , , - ).Tolerances () - .

    14, " ".

    . 14.1. Lines and Arrows ( ) : Dimension

    Lines ( ), Extension Lines ( ), Arrowheads () Center Marks for Circles ( ).

    Dimension Lines. -

    , , Color () . , , -, Other () Select Color (), . , - , ByBlock, . , . - , , , . , , , .

    Lineweight ( ) - . ByBlock, .. , . , .

    Extend beyond ticks ( ) , . - , Extend beyond ticks . - Arrowheads () - Architectural Tick ( ) Oblique (). - . . 15.4 0,1 .

    24'~0"

    . 15.4. . - ; ,

    428 II.

  • Baseline spacing ( ). AutoCAD .

    (. 15.5). , Suppress (). , , , .. - , .( , ^) -, .

    . 15.5.

    Extension Lines. ,

    , , . Color () . , , , O t h e r Se-lect Color, . - ByBlock, .

    , . Extend beyond dim lines ( ).

    , , - 1. Offsetfrom Origin ( ) Extension Line.

    , . Suppress. ( AutoCAD - .) . 15.6 - .

    1 " ". . .

    15. 429

  • 3.5000

    . 15.6. ! .

    -

    Arrowheads (). , - (. . 15.4). , . 1st Arrowheads 2nd. , , , . , , .

    AutoCAD . ( , 18, " "). - , . Arrow-heads User Arrow ( ) Select Custom Arrow Block ( ) . 15.7. .

    slum Ariuw Him k

    . 15.7. Select CustomArrow Block

    . 15.8 , .

    - . Leaders (-).

    430 II.

  • . IS,8. ,

    Arrow size ( ) Arrow-heads, , ( ).

    Center Marks for Circles ( )

    New Dimension Style , - Center Mark ( ) - Dimension () ( DIMCENTER). - () Mark (), - Line (). , - , - (. 15.9).

    +- 3 . 5 0 0 0

    . 15.9. - - - -

    Size () - . Mark -, Line - .

    STANDARD -, ( ) . .

    abl5-a.dwg, - Drawings -.

    15. 431

  • . 1. 5 - . dwg, -.

    2. abl5- l .dwg AutoCadBible . . 15.10 ; Inter-section () Endpoint (), Dim. Dimension (), - Dimension.

    GARAGE SOUTH ELEV 1/4" = T-O"

    . 15.10.

    3. STANDARD, LinearDimension ( ) Dimension. - Specify f i r s t e x t e n s i o n l i n e o r i g i n or < s e l e c t o b j e c t > :( :) 1(. . 15.9). Specify second e x t e n s i o n l i n eo r i g i n : ( :) 2. Specify dimension l i n e l o c a t i o n or[Mtext/Text/Angle/Hor izonta l/Ver t ica l/Rotated] : (

    [/////]:) , - . , .

    432 II.

  • 4. Zoom Window ( ) Zoom() , 1 . Zoom Previous ( ) . . - , .

    5. Dimension Style Dimension. - STANDARD. New DimensionStyle Manager. New Style Name Create New DimensionStyle Arch 48 Continue ().

    6. Lines and Arrows ( ). Arrowheads() Oblique (), - Size 3/16". Dimension Lines () 3/32 Extend beyond ticks ( ). , Dimension Style Manager.

    7. Dimension StyleManager , . Set Current ( ), Close.

    8. , . 3 . Dim Style Control ( ) ( Dimension) Arch 48. - " " - , New DimensionStyle. , -, . Zoom . . ( Zoom Previous).

    9. , , .

    Text () New Dimension Style,

    , - . 15.11.

    -

    .

    Text Style ( ), , ., , ( , ) , , .

    13, " ".

    15. 433

  • ItejNfiw Di sin Styl.r

    ~~ *

    . 15.11. Text New Dimension Style

    Text color. - , -, . , - , , Other Select Color, . , , ByBlock, - . , . , , .

    Text height . , , -, . , - , 0. Text ().

    , Fractionheight scale ( ) - . , , 1, .

    Vertical -

    . . 15.1. .

    Horizontal ( ) - - (. 15.2), - .

    II.

  • ; 15.1.

    Centered ( )

    Above ( )

    Outside ()

    J/5 ( - )

    , , . . 15.52

    . - (. . 15.4)3

    JIS, (Industrial Standards Rules), -

    [ 15.2.

    Centered ( )

    At Ext Line 1(Ma 1- )

    At Ext Line 2( 2- )

    Over Ext Line 1( 1- )

    Over Ext Line 2( 2- )

    -

    , - S p e c i f yf i r s t e x t e n s i o n l i n e o r i g i n o r < s e l e c t o b j e c t > : . n p n -, . . 15.12 , At Ext Line 1. , -

    ,

    , At Ext Line 1

    , At Ext Line 1

    Offset from dimline. , - . , , , Offset from dim line, - . .

    , , AutoCAD , Offset from dim line,

    . - - .

    . . . . . .

    15. 435

  • 3.2965

    1.7799

    3.5000

    2.0665

    . 15.12. 1- 2- - , - , -

    Alignment () Text

    , .

    Horizontal (), (, ).

    Aligned with dimension line ( -), ,

    ISO Standard, ISO. -, - , , - .

    , , - .

    abl5- l .dwg, - Results -.

    . 1. , ,

    5 - 1 .dwg, R e s u l t s -. , Intersection () Endpoint (), Dim. Dimension, - Dimension.

    2. 5 - 2 . dwg AutoCad B i b l e .

    436 II.

  • 3. Dimension Style Dimension. - ARCH 48. Modify , . Modify DimensionStyle Text.

    4. Text Appearance ( ) ROMANS .

    5. Tolerances () , . Method . Text - Fraction height scale 0.75. Toler-ances None. - Text. ( , .)

    6. Text Placement ( ) Vertical Above ( ).

    7. Text Alignment ( ) Aligned withdimension line ( ). , , .

    8. , Close. AutoCAD - , . - , .

    9. , , .

    , , AutoCAD - . Fit New Dimension Style (. 15.13).

    Fit Options Fit Options () , -

    AutoCAD - . - , - .

    , - .

    ! . - , - .

    15. 437

  • fQNew Dimension Stylp: arch

    If there enouah mwn to placo both taiendanOminwteextentwrtSnej.thefttt

    ( * itetwtthe MOW,whichever 8* bt

    , . '''.

    , Both text id tow

    Alweju keep taxt between

    SiMeoj if tW? doom bride; , the extension tries

    1.0159-1-

    1.1955

    j - Scale ftwsmtfln FeatoMt-

    ' ff

  • , . , . . 15.19 , Suppressarrows if they don't fit inside the extension lines Either thetext or the arrows, whichever fits best.

    . 15.16. - - Text

    . 15.17. - - Both text and arrows

    . 15.18. - - Always keep textbetween ext lines

    Text Placement

    Puc. 15.19. - Suppress arrowsif they don't fit inside theextension lines Either thetext or the arrows, which-ever fits best

    Text Placement ( ) , - AutoCAD , .

    Beside the dimension line ( ). - . . 15.20 , , , - , . , . .

    Over the dimension line, with a leader ( , ). , , ; - . (. 15.21).

    15. 439

  • .52

    . 15,20. . - ,

    ,52

    ,0,52

    . 15.21. - . , .

    Over the dimension line, without a leader ( , ). - , - ; (. 15.22). .

    . 15.22.

    Scale for Dimension Features ( )

    . , , , - . - , - . - Overall Scale( ), AutoCAD - .

    440 //.

  • 5, " ", 17, " ", .* .

    Fine Tuning Place text manually when dimensioning (

    ), AutoCAD , , , Specify dimension l i n e l o c a t i o n or[ M t e x t / T e x t / A n g l e / H o r i z o n t a l / V e r t i c a l / R o t a t e d ] : .

    , . , , r _ r f f . J 5.23. ,

    , - .

    Always draw dim line between ext lines , , , (. 15.23).

    5-2 .dwg, - Results -.

    . 1. 5-2. dwg ,

    , 5 - 2 .dwg, R e s u l t s -. , , Intersection Endpoint, Dim. Dimension, - - Dimension.

    2. 5 - 3 .dwg AutoCad Bible .

    3. Dimension Styles Dimension. - ARCH 48. Modify , . Modify DimensionStyle Fit.

    4. Text Placement Fit Over the dimensionline, with a leader ( , ).

    5. Fine Tuning Always draw dim line between ext lines( ). - , .

    6. 1:48, .. '/4"=, Overall Scale () 48.

    15. 441

  • 7. , Close. , .

    8. , , -. , . 15.24.

    . 15.24. SOUTH ELCV ! / * " - -0'

    Primary Units

    New Dimension Style (. 15.25). 5, " ", - AutoCAD. .

    t

    . 15.25. Primary Units NewDimension Style

    Linear Dimensions ( ) Primary Units ( -

    ) .

    442 II.

  • Unit format (). , Drawing Units, Scientific (), Decimal (), Engineering(), Architectural (), Fractional ( ) Windowsdesktop ( Windows).

    , Windows desktop, Windows Start=>Settings^Control Panel^Regional Settings (1^1* ^ ). Windows - , AutoCAD, - Windows.

    - , Precision ().

    Fractionformat. , , - ( Fractional Unit format). Hori-zontal -, Diagonal , NotStacked , -. - .

    Decimal separator ( ), - Decimals Unit format, , (Period), (Comma) (Space).

    Round off () - . , 0.1 1/2 ( , , ).

    Prefix Suffix - , - . , , - ( , , , ).

    Scale factor . , , - AutoCAD. , Scale factor 0,5, 2.5 , AutoCAD, - 1,25. 25.4, , AutoCAD, , - , .

    Paper Space Only ( ), - .

    Zero Suppression ( ) , - . ( Leading), 0.375 . 375. - ( Trailing) 3.7500 3 . 7 5 .

    0 Feet (0 ) 0 Inches(0 ); 0 Feet (0 ) 0'-8" - 8", 0 Inches (0 ) '-" 6 ' .

    15. 443

  • Angular Dimensions Primary Units

    . Units format : Decimal Degrees ( ), Degrees Minutes Seconds(//), Gradients () Radians ().

    Precision . Zero Suppression

    . , 37.0 - 37 .

    ,

    , , - AutoCAD . -, Alternate Units New Dimension Style(. 15.26). Display alternate units ( ).

    New Dimension Style: dicliilI. w>JAi|'iw

    -?.SJI-* J~

    1 ~ d-

    . 15.26. Alternate Units NewDimension Style

    , Primary Units ( ), . 25 . 4, Multiplier foralt units ( ). - 25.4 =1". , - .03937 (0,03937"=1 ). , - , , .

    . 15.27 - ,

    444 II.

  • . 15.27. (, ). (Jerry Batlenfield), Clow Valve Company, , turn.

    Placement () - .

    abl5-3.dwg, - Results -.

    . 1. abl5-3.dwg , -

    , abl5-3.dwg, R e s u l t s - -. - - Intersection Endpoint, Dim. Dimen-sion, - Dimension.

    2. 5-4 .dwg toCad Bible .

    3. Dimension Styles Dimension. ARCH 48. , Modify. Modify Dimension Style Primary Units { ).

    4. Unit format ( ) Architectural

    ().

    5. Precision '- 1/8".

    6. Fraction format ( ) Diagonal ().7. Zero Suppression ( ) 0 Inches, -

    ( , ) . .

    8. . Dimension Style Manager Set Current ( ), Close.

    15. 445

  • , AutoCAD - .

    9. , - -, , - 1 2, - . 15.28. .

    10. , .

    11. , - , . 15.28.

    . 15.28.

    . Tolerances New Dimension Style (, 15.29).

    I !Ni-wl)iMii!i

    -tZeia SuppfMiltn

    Olnchet

    l ' "ZeroSupfMMion1 - " Qftftb ' -11

    . 15.29. Tolerances NewDimension Style

    Tolerance Format Tolerance Format ( ) -

    . Method () Auto-CAD .

    446 II.

  • Symmetrical (). - / (. 15.30). Upper Value.

    . 15.30.

    Deviation (). , "", "" (. 15.31). UpperValue Lower Value,

    . 15.31.

    Limits ( ). - (. 15.32). Upper Value Lower Value.

    Basic (). (. 15.33). - , .

    15. 447

  • 2.55702.5320'

    0.0015

    1.65201.6270

    . 15.32.

    . 15.33.

    Precision . , Upper value - . - Upper value, Lower value.

    Scaling for height. , , . 1 , , , , - . 0.5 , - , .

    Vertical position ( ) , - - . , , Deviation, - .

    () .

    Middle () .

    Bottom () - .

    448 II,

  • ^0 Vertical position -

    . Tolerances. Verti-cal position . , - None ().

    I

    Zero Suppression , , - , . -, Primary Units.

    , Alter-nate unit tolerances , , .

    , , Close. - .

    , , -

    , . - . . . .

    Dim Style Control Dimension , - .

    , , , - .

    , -

    - . , - "" ( ) , . .

    1. Dimension Style Dimension.

    2. New ().

    3. Use For ( ) , - .

    4. Continue ().

    5. , , .

    15. 449

  • 6. , Dimension Style Manager. , () .

    7. Close (),

    - . , .

    , -, , Properties () - . Properties, "+" Misc . Dim style ( ). , - . .

    Properties, .

    , Match Properties ( ). - .

    1. Match Properties.

    2. S e l e c t Source O b j e c t : ( -) , .

    3. S e l e c t d e s t i n a t i o n o b j e c t (s) or[ S e t t i n g s ] : ( ()-() []:) , -. ( Settings (), , .)

    4. .

    , -

    , . .

    1. Dimension Style Dimension.

    2. , .

    3. Modify.

    4. AuioCAD Modify Dimension Style, New Dimension Style

    450 II.

  • . . - Dimension Styles Manager.

    5. Close.

    AutoCAD .

    , , , - , Properties. -

    , Properties. ft-.'* "+", ,

    , . , - Dim Style^Save as New Style ( ). New Dimension Style, - . .

    :

    , - . - , , . - Properties.

    , . - . -, , . , . AutoCAD .

    .

    1. Dimension Style Dimension.

    2. Dimension Styles Manager , .

    3. Override Dimension Style Manager.

    4. AutoCAD Override Dimension Style, - , New ( Modify) DimensionStyle. .

    5. Dimension Style Manager . Close.

    , - .

    , - Dimension Style Dimension Style Manager. - .

    1. Delete .

    15. 451

  • 2. Save to Current Style , "".

    3. Rename - .

    Dimension Dimension Update (), . - , , , .

    ModifyDimension, Update , .

    ,

    . .

    1. Dimension Style Dimension Dimension Styles Manager. Compare. Auto-CAD Compare Dimension Styles ( ), . 15.34.

    imension Slyles

    Ortctfcfcn - - iFit (ext movementPiecuionText offsetTextileToldevbweiTddrvippeiTo/ deviationTol precisionT cl text scale fsGloi

    |- ~DIMTMOVEOIMDECDIMGAPDIMTXSTVDIMTMDIMTPDIMTOLDIMTDECDIMTFAC

    0i0.050STANDARD0.0100.O15Off40 750

    & I230.090ROMAUD0 0050.005On30500

    . 15.34. Compare DimensionStyles

    2. Compare () With ( ) - . AutoCAD , . - .

    3. Close , - .

    452 .

  • Windows - .

    Compare Dimension Styles.i "

    - , . , -. , , -, , ? AutoCAD AutoCAD DesignCenter. .

    1. AutoCAD DesignCenter . DesignCenter.

    2. , .

    3. " + " .

    4. ( , - ) .

    5. .

    6. DesignCenter Close .

    5, " ", AutoCAD (, Dimension Styles ).

    Help&AutoCAD Help Topics (^ ) - Contents (). Command Reference ( ), System Variables( ), D. - , DIM.

    - . , . - AutoLISP - . , , AutoLISP, .

    15. 453

  • DIMSTYLE (). -dimstyle. -, AutoCAD - , STatus ().

    Command -dimstyle

    Current dimension stylo STYLE1Current dimension overrides.DIMGAPDIMSCALEDIMTMDIKTOL

    -0 0500 OOO0 010Off

    Enter a dimension style option[Save/Restore/STatus/Variables/Apply/?] (Restore> stDIMASODIM5TYLEDIHADECDIMALTDIMALTDDIMALTFDIMALTRNDDIKALTTDDIMALTTZDIMALTUDIMA1TZDIMAPOSTDIMASZDIMATFITDIHAUHITDIMAZINDIMBLK11

    OffSTYLE1

    0Off225 4000.0002020

    0.18030ClosedFilledClosedFilled

    Create dinension objectsCurrent dimension style (read-only)Angular dec ma1 placesAlternate units selectedAlternate unit decimal placesAlternate unit scale factorAlternate units rtfunding valueAlternate tolerance decimal placesAlternate tolerance zero suppressionAlternate unitsAlternate unit zero suppressionPrefix and suffix for alternate testArrow sizeArrow and text fitAngular unit formatAngular zero supressionArrov block First arrov block

    DIMLUEDIMPOSTDIMRHDDIHSAHDIMSCALEDIMSD1DIMSD2DIMSE1DIMSE2DIMSOXDDIHTADDIhTDECDIMTFACDIMTIHDIMTIXDIMTMDIMTHOVEDIMTOFLDIHTOHDIKTOLDIMTOLJDIMTPDIMTSZDIMTVPDIMTXSTYDIMTXTDIMT2INDIHUPTDIHZIH

    -2

    000Off0 000OffOffOffOffOff0i0 750OnOff0 0100OffOnOff1D 0150 0000.000STANDARD0 1800Off0

    Extension line lineveighlPrefix and suffix for dimension textRounding valueSeparate arrov blocksOverall scale factorSuppress the first dimension lineSuppress the second dimension lineSuppress the first extension lineSuppress the second extension lineSuppress outside dimension linesPlace text above the dimension lineTolerance decimal placesTolerance tent height scaling factorTestt inside extensions is horizontalPiece text inside extensionsMinus toleranceText movementForce line inside extension linesText outside horizontalTolerance dimensioningTolerance vertical justificationPlus toleranceTick sizeText vertical positionTest styleText heightTolerance zero suppressionUser positioned textZero suppression

    , D I M S T Y L E , . STatus, DIMSTYLE .

    save (). .

    Restore (). .

    v a r i a b l e s (). , STatus, , - . - .

    454 II.

  • A p p l y (). . Dimension Update - Dimension.

    ?. .

    - . D I M O V E R R I D E () Dimension v a r i a b l e to o v e r r i d e (or C l e a r to removeo v e r r i d e s ) : ( , ( - ):) . - , - . - : 1 (, . 15.35). Specify secondextens ion l i n e o r i g i n : 2. ( - &1 , , Y.) Specify dimension l i n e l o c a t i o nor [ M t e x t / T e x t / A n g l e / H o r i z o n t a l / V e r t i c a l / R o t a t e d ] : - , - .

    5. Dimension Style Dimension. Dimension Styles Manager Override - Tolerances Modify Dimension Style. - Tolerance Method None. Lines and Arrows. Extension Lines Suppress Ext Line 1 , - . . Dimension StyleManager Close.

    15. 455

  • FUWES BE KEKlKCftO PyjWUJL W1HN ,015 TJ.R.

    (35 tnTYP

    ooU

    RAT BUNK LAYOUT

    ft/c. 15.35. ,

    6. Linear Dimension Dimension Specify f i r s t e x t e n s i o n l i n e o r i g i n or < s e l e c to b j e c t > : 2 (. . 15.35). Specify second e x t e n s i o n l i n e o r i g i n : - 3. Specify dimension l i n el o c a t i o n o r [ M t e x t / T e x t / A n g l e / H o r i z o n t a l / V e r t i c a l / R o t a t e d ] : , .

    7. , , 4, - . Dimension Update Dimension. S e l e c t o b j e c t s : . .AutoCAD - , .

    8. , , Dimension Style Dimension. Dimension Styles Manager Compare (). Compare DimensionStyles Compare () , - With ( ) LIN. AutoCAD -, . ., Close.

    9. ( ) - Dimension Style Man-ager Delete (). AutoCAD -

    456 //.

  • - Are you sure you want to d e l e t e " < s t y l e overr ides>"?( , ""?). Yes (). Dimension Style Manager Close .

    10. Linear Dimension Dimension Specify f i r s t e x t e n s i o n l i n e o r i g i n or < s e l e c to b j e c t > : 4 (. . 15.35). Specify second e x t e n s i o n l i n e o r i g i n : - 5. Specify dimension l i n el o c a t i o n o r [ M t e x t / T e x t / A n g l e / H o r i z o n t a l / V e r t i c a l / R o t a t e d ] : .

    . , CIR LIN DimensionStyle Dimension. Dimension Styles Man-ager Compare. Compare Dimension Styles Compare LIN, With CIR. AutoCAD , - . 15.36. Close - , .

    Compete Dimension Styles

    DejcnttoiPieciaonTe>t insideTertoffsetTextsMeToldev lowerTd dev uppeiTol deviationTolpreusion

    tVaabteDIMDECPIMTC-DIMGAFD1MTXSTYDIMTMDIMTPD1HT0LDIMTDEC

    lutr3On3/32ROWANS00On3

    1OT 14Oil3/32STANDARD .1/32.1/32OilA

    . 15.36. CIR LIN

    12. . , . 15.37.

    - . AutoCAD - : TOLERANCE(). -, - , ISO (International Standard Organization -

    15. 457

  • ), ANSI (American National StandardsInstitute ) JIS (Japanese Indus-trial Standard ). . 15.38 .

    . 15.37. ,

    ' 0,0015

    . 15.38. . - . (Jerry Bottenfield) Clow Valve Company,, .

    rg- : Tolerance () -L..^ Dimension Geometric Tolerance( ) . 15.39.

    . - , ( ), - .

    .

    458 II.

  • 1. Sym Symbol(), . 15.40. Dia () Tolerance 1 ( 1).

    SjGeomeiric ToleranceSjB-t

    . 15.40. Symbol

    . 15.41. Material Condition

    . 15.39. Geometric Toierance

    2. ( ) ( . 15.3). - Symbol. - , .

    3. Dia () Tolerance 1 ( 1).

    4. Value ().

    5. (), Material Condi-tions ( ), . 15.41. .

    6. - Tolerance 2 ( 2).

    7. , , - Datum () Datum 1 ( 1) .

    8. . 3 , .

    9. Datum () Datum 2 ( 2) Datum () Datum 3 ( 3) .

    10. , Height(), Projected Tolerance Zone ( ) .

    . , - Datum Identifier ( ).

    12. .

    , Material Conditions, , .

    15. 459

  • Z/

    , 8

    -

    ,

    . AutoCAD - E n t e r t o l e r a n c e l o c a t i o n : ( ). .

    - .

    . -

    Geometric Tolerance ( ), , .

    -5-c.dwg, - Drawings -.

    . 1. 5- . dwg, -.

    2. abl5-6.dwg AutoCad Bible. . 15.42 , Dim. Dimension, - Dimension.

    460 II.

  • 75/77

    J

    45' chamfer typ

    . 15.42. : ,

    3. Tolerance () Dimension. - Geometric Tolerance, Sym.

    4. Symbol () - ( ).

    5. Dia - Tolerance 1 Geometric Tolerance. .004 Value (). - (), - Material Conditions ( ). ( - ) .

    6. Datum Datum 1 .

    7. E n t e r t o l e r a n c e l o c a t i o n : ( ) 1, . 15.42.

    8. , . 15.43.

    . 15.43. -

    15. 461

  • -

    . New Dimension Style, .

    , -. , AutoCAD DesignCenter.

    , . - , , .

    .

    462 .

  • 1

    - AutoCAD -

    . - , , , - [-,.. . [>,; - L , ?;, . \ ', - V , - , &.. . - >, .

    , . , , , . . ", - . , - . - t

    ... Ju_- -.-

    .

    ,

  • r

    I D

    , - .

    , - . 16.1, RECTANG() POLYGON ().

    . 16.1.

    PLINE

    Polyline () - Draw (). PLINE (), - Specify s t a r t p o i n t : ( :). - Specify next p o i n t or [Arc/Close/Halfwidth/Length/Undo/Width]:( ^/////]:). .

    Arc (). -, .

    Close (). , .. .

    Halfwidth (). , .. . AutoCAD - - .

    Length (). , , , - .

    Undo (). .

    Width (). . AutoCAD . .

    Spec i fy n e x t p o i n t ( ). .

    LINE (), PLINE , .

    Arc () AutoCAD - Speci fy e n d p o i n t of a r c or [ A n g l e / C e n t e r / C l o s e / D i r e c t i o n /Halfwidth/Line/Radius/Second pt/Undo/Width] : (

    464 II.

  • [./////////];). - .

    Angle (). .

    CEnter (). .

    CLose (). , .. .

    D i r e c t i o n (). .

    Halfwidth (). , .. . AutoCAD - - .

    Line (). , - .

    Radius (). .

    Second pt (). .

    Undo (). .

    Width (). . AutoCAD . .

    Specify endpoint of a r c ( ). . , - - .

    , Line .

    , . -, . , , . AutoCAD , . , - . - . - P L I N E G E N ( ). pUnegen

  • . 1. - . dwg, -.

    2. 6 - 1 . dwg AutoCad Bible . . 16.2 -, Endpoint (), Midpoint () Intersection(). 3 .

    f

    1

    2

    !

    1

    1

    . 16.2. : . - (Mary Redfern), Bethlehem Steel Corporation, , .

    3. Polyline Draw, - :Specify f i r s t p o i n t : Snap From () - Object Snap ( )Specify base p o i n t : 1, . 16.2: @-1/2,0

  • 8.
  • E d i t v e r t e x (). - , .

    F i t (). , .

    S p l i n e (). , - , . , - SPLINE (), - (), .

    Decurve ( .). , F i t S p l i n e .

    Ltype gen (). - PLINEGEN.

    Undo (). .

    e x i t (). PEDIT.

    . - P E D I T , .

    O b j e c t s e l e c t e d is n o t a p o l y l i n e . Do youwant to t u r n i t i n t o one? ( -. ? ) AutoCAD . . , -, J o i n (), . AutoCAD , . -, .

    E d i t v e r t e x () AutoCAD - : E n t e r a v e r t e xe d i t i n g o p t i o n [ N e x t / P r e v i o u s / B r e a k / I n s e r t / M o v e / R e g e n / S t r a i g h t e n /T a n g e n t / W i d t h / e X i t ] : ( [/////////] :). . - .

    Next (). .

    Prev ious (). .

    Break (). . - Go () , . , Next () Prev ious() , Go (). . eXit(). BREAK ().

    I n s e r t (). .

    Move (). .

    468 .

  • Regen (). .

    S t r a i g h t e n (). . , Break () Next(), Prev ious (), Go () eXit (). , - AutoCAD - , . .

    Tangent (). , - F i t ().

    Width (). , - . ( Regen ()).

    X i (). .

    P E D I T () UNDO () . -

    ! undo P E D I T .

    , .

    P E D I T , , .

    !

    , PEDIT - M u l t i p l e (). - m , Multiple. E n t e r an o p t i o n [Close/Open/Join/Width/F i t / S p l i n e / D e c u r v e / L t y p e gen/Undo] :. . -, , , S p l i n e ().

    M u l t i p l e , - . , - Join. .

    Fuzz d i s t a n c e ( ). , . , , , , . - , - .

    J o i n t y p e ( ). . Extend (), - ( ) , Add (), . Both (), - , .

    16. 469

  • Properties

    - Properties ( Properties () , -). Properties, . 16.4.

    -, Vertex Geometry. - , , . , Pick a Point ( ), - . - .

    , , Misc , . PLINEGEN, - Linetype generation, Enabled. , - , , , , .

    [Properties-li:af)Hi-3.rtwg - Read...E3j

    j Polyline

    General

    Cotof

    Layer

    Linetype

    Linetype scale

    Plot styleLmeweighl

    Hyperlink

    Thickness

    Geometry

    Vertex X

    Vertex Y

    Start segment width

    End segment widch

    Global iwJth

    Elevation

    Area

    Closed

    Line type generation

    ByLa,er3

    ^ h -

    1.00000

    - 1 -

    0

    l * !

    61 2

    23/32

    00

    'MoCHsabled

    5pecftes the current vertex of the icfrtweigt*

    . 16.4. Properties,

    -b.dwg, - Drawings -.

    . 1. 6-. dwg, -.

    2. ~2 .dwg AutoCad Bible. . 16.5 , .

    3. PEDIT Modify^ObjectoPolyline(^^), , - . 16.5 1.

    4. Enter an o p t i o n [Close/Join/Width/Edit

    v e r t e x / F i t / S p l i n e / D e c u r v e / L t y p e gen/Undo] : w

  • . 16.5. . -. : (Henry Dearborn), 1, ,.

    5. E d i t v e r t e x ()

  • , , - .

    . 16.6. ,

    Spline () Draw(), Speci fy f i r s t p o i n t or[Object] : ( [];) , , -

    S p l i n e PEDIT. ( - , - .) ( - , ) .

    AutoCAD Specify next p o i n t : ( :), . AutoCAD - Speci fy n e x t p o i n t or [ C l o s e / F i t t o l e r a n c e ]< s t a r t t a n g e n t > : ( [/ ] :). .

    Close (). , , . -, ( ) . - .

    F i t Tolerance (). , . - 0, .. . - 0,5 , . 5.

    Specify next p o i n t ( ). . . .

    S t a r t t a n g e n t ( ). - AutoCAD - . . , - , , - , .

    -c.dwg, - Drawings -.

    472 II.

  • . 1. - . dwg, -.

    2. - 3 .dwg AutoCad Bible . . 16.7 , - Insert ().

    \

    \

    . 16.7. , -

    3. Zoom Window ( ) Zoom(), - , . Spline Draw.

    4. Specify f i r s t p o i n t or [Object] : (. . 16.7). , N-EDGE-DR. - Pan Realtime ( - ) , . , . .

    5. Specify s t a r t t a n g e n t : ( ) Specify end t a n g e n t : ( ) - .

    6. SPLINE, , , - ( S-EDGE-DR). 1 -, - . , - , .

    7. Zoom Previous ( ) - .

    16. 473

  • , -

    . , - , .

    AutoCAD - {fit points). , , . - . SPLINEDIT F i t Data ( ). .

    (controlpoints) , , . , -, , . SPLINEDIT Move Vertex ( ) , , , .

    . 16.8 , , .. . - , .

    . 16.8. , -

    . 16.9 , , - - . .

    . 16.9. . 16.8 , - - us

    . 16.10 , . AutoCAD -

    , . , - Move Vertex Refine () , AutoCAD . -, , , - . , F i t Data ( ) - .

    474 //.

  • . 16.10. , -

    SPLINEDIT (). Modify=> Objects Spline (^ 1^ ). E n t e r an o p t i o n [ F i t d a t a / C l o s e /Move v e r t e x / R e f i n e / r E v e r s e / U n d o ] : ( [ // ///]:), .

    F i t D a t a ( ). , , - . - , ( ).

    Close/Open (/). - , - , ( ) , . , Open (). - , .. . . C l o s e (), Open() .

    Move V e r t e x ( ). , E d i tV e r t e x PEDIT, , - . - Next () P r e v i o u s (), - , .

    R e f i n e (). - - .

    . , .

    . - , .

    . , , - . , - , .

    r E v e r s e (). ,

    .

    Undo (). .

    16. 475

  • SPLINEDIT - , . . 16.11 - .

    . 16.11. SPLINEDIT - ,

    F i t Data ( ) - E n t e r a f i t d a t a o p t i o n [Add/Close/Delete/Move/Purge/Tangents/toLerance/eXit] :' ( [//// .///] :). - .

    Add (). - AutoCAD . . . - .

    Open/Close (/). -, .

    D e l e t e (). .

    Move (). . - Next () P r e v i o u s (), , . , AutoCAD - . .

    Purge ( .). .

    Tangents (). . - , AutoCAD .

    t o L e r a n c e (). , .

    e x i t (). .

    ^j^f00 SPLINEDIT.

    476 .

  • F i t Data ( ) , (. 16.12).

    . 16.12. Fi t Data - ,

    , Properties ( Properties () , - ). - . , - , .

    abl6-3.dwg, - Results -.

    . 1. abl6-3.dwg, -,

    .

    2. 6-4 .dwg toCad Bib le .

    3. Zoom Window Zoom, (. 16.13).

    . 16. S3. , SPLINE

    16. 477

  • 4. MOVE () S-EDGE-DR - . , ( OSNAP () ).

    5. Modify^Object^Spline - S e l e c t s p l i n e : , -. , , - . , . - .

    Enter an option [Fit data/Close/Movevertex/Ref ine/rEverse/Undo]: - Fit data ( ) ( f

  • . 16.14.

    . 16.15. -

    friv; Region () LET; Draw, . -, AutoCAD :

    1 Icop extracted.1 Region created.

    . - , AutoCAD :

    loop extracted.

    Region created.

    ~0&01' R E G I O N () 0 DELOB J.

    , , - Endpoint () . - . - TRIM () EXTEND (). , , , - BOUNDARY (), .

    16. 479

  • , - . . , AutoCAD , ; :

    1 c losed, degenerate or unsupported ob jec t r e j e c t e d .

    , ( ). - UNION (), SUBTRACT () INTERSECT (). 24, " ", - .

    - d . d w g , - Drawings -.

    . 1. - d . dwg, -.

    2. 6-5 .dwg AutoCad Bib le .

    . Region Draw, - S e l e c t o b j e c t s : - (. 16.16). . AutoCAD - :7 loop e x t r a c t e d .7 Region c r e a t e d .

    . 16.16. -,

    ^ t R E G I O N , .

    BOUNDARY ()

    . , REGION(). . , 12, " ", BOUNDARY , . , .

    480 II.

  • Draw^Boundary (1^) Boundary Creation ( ), . 16.17.

    1 1 . , -

    1

    f -

    ' food

    3 1 "

    or ^

    tng

    .- ' ^

    Cam

    PMC. /6.77. Boundary Creation

    Boundary Hatch, . - Boundary Creation , - .

    Object Type ( ) Region() Polyline (), , -. , Boundary Set - Current Viewport ( ). , - , New (). AutoCAD , , - . , - Boundary Creation, Pick Points ( ). - S e l e c t i n t e r n a l p o i n t s : ( :). , , - AutoCAD:

    Selecting everything.-.Selecting everything visible...Analyzing the selected data...Analyzing internal islands...

    AutoCAD , . - , . AutoCAD , .

    BOUNDARY - .

    16. 481

  • BOUNDARY - - .

    6-.dwg, - Drawings -.

    . 1. a b l 6 - e .dwg, -.

    2. , . 16.18, - .6-6 .dwg AutoCad Bible.

    3. - Boundary Creation - Draw^Boundary. - Object Type Region.

    4. Pick Points.

    5. S e l e c t i n t e r n a l p o i n t s : 1.

    6. , :4 loop extracted.4 Regions created.BOUNDARY created 4 regions.

    7. MOVE - S e l e c t o b j e c t s : 2. ; , .

    8. .

    . 16. IH. '

    , .

    . , - , . AutoCAD , .

    31, " ", - , , 4t . A

    482 //.

  • . 16.19 , .

    01 5/16

    R1/16

    1 11/16

    Ri/

    . 16.19. . - (Jerry Bottenfield), Clow Valve Com-pany, , .

    .

    -, , .. , -, . ( - 18, " ".)

    -, , .. .

    , .

    , - . AutoCAD - . . - BOUNDARY () REGION ().

    a c a d . p a t , .pat .

    ,

    . , , -' , .

    16. 483

  • Hatch () -.,,.,, Draw. () Boundary Hatch ( ), - Quick () . 16.20.

    Quefc | Advanced)

    \ WtjAS=i31 J

    - L **( 1 _ . .

    3 '-

    1 "* i

    RcfcPort.

    : - * | 1 * 4 1 p (

    . 16.20. Boundary Hatch, Quick

    ( ) .

    Predefined (). - .

    User-defined (). , , .

    Custom (). , . pa t .

    Pattern (). : , . 16.21 Hatch pattern palette ( ), - .

    , - . , , Pattern Boundary Hatch, - . .

    Custom pattern ( ) , Custom.

    Angle (). - , . . 16.22 0, ANSI31 .

    484 II.

  • PiHatcli Pattern Paletteim1 iso'

    ANGLE

    AR-B816C -68 AR-BRELM

    1'

    I

    . 16.21. Hatch patternpalette, Other Predefined

    Scale(), AutoCAD . 1 ( ) , ; . 5 -. . 16.22 ANSI31 : 1, . 5. - , . 17, " ".

    . 16.22. -

    Pattern Type ( ) - User-defined () Spacing ().

    16. 485

  • , . . 16.23 , , 45, 0.1 .

    1. Hatch Draw. Boundary Hatch.

    2. User-defined.

    3. Angle () .

    4. Spacing () -, .5 0,5 .

    1 4 '

    rVV4

    WWW

    7 / 3

    ^ i

    ^ R1/16

    i

    . 16.23. - ,

    - Double (-). ISO Pen Width ( ISO)

    ISO. AutoCAD - . - ISO Pen Width ( ISO) - Scale (). , .

    .

    . , . , , , AutoCAD .

    Boundary Hatch -: .

    Select Objects ( -) , -

    486 II.

  • . . Remove () Add (). Boundary Hatch, .

    , Pick Points ( ). AutoCAD - , BOUNDARY () . :

    Select internal point: Selecting everything...Selecting everything visible...Analyzing the selected data...Analyzing internal islands...

    AutoCAD (boundary set), - . S e l e c t i n t e r n a lp o i n t : ( ;) , - . -, a AutoCAD , - . Boundary Hatch .

    , , -

    .

    .

    Enter (BK). .

    Undo Last Select/Pick ( ). - .

    Clear All ( ). .

    Pick Internal Point ( ). .

    Select Objects ( ).

    Normal Island Detection ( ). - .

    Outer Island Detection ( ). .

    Ignore Island Detection ( ). - .

    Preview ( ). .

    - , -. , AutoCAD, .

    OK AutoCAD .

    16. 487

  • , .

    , , , - , Preview.

    , View Selection ( ).

    , , / Inherit Properties ( ). AutoCAD - , -. Boundary Hatch.

    Nonassociative Composition, - .

    Remove Islands .

    {islands) -

    , - . - . . 16.24 ( ), - - , .

    . 16.24. - . - (Jerry Bottenjield), ClowValve Company, sa, .

    , - .

    , , -

    . , , , , . , , . (.. -, ), , - , .

    , Advanced () Boundary Hatch, . 16.25.

    Island Detection Style ( ) .

    488 .

  • Rnunrtflry Hatch

    jCuirenl v i e w p o r t ] , Q j | ( .^,",.t J 3

    /*. 16.25. Boundary Hatch, Advanced

    Normal (). : , , ..

    Outer (). , - .

    Ignore (). , .

    16.26 . , , - Remove ().

    Normal Outer Ignore

    \\ -[

    . 16.26.

    , , AutoCAD -

    . -

    16. 489

  • Remove Islands ( ) Boundary Hatch. , .. . , - . 16.26 , - Ignore (), .. .

    Advanced , ,

    , . - , AutoCAD .

    - AutoCAD , BOUNDARY () . Retain boundaries { ) Advanced - Object Type ( ), Polyline () Region (). ( ). - BOUNDARY .

    ipynne Island detection method AutoCAD, . Flood , a Ray casting .

    .pat- ( ) DesignCenter

    .

    , - 2000L AutoCAD LT.

    !

    , DesignCenter.

    1. AutoCAD DesignCenter. ( ), DesignCenter.

    2. \AutoCAD 2 0 0 2 \ S u p p o r t . , Desktop ( ).

    3. " + " , S u p p o r t , . pat- . a c a d . p a t . ( , . pat- - , .)

    4. DesignCenter . -, , Boundary Hatch, .

    490 II.

  • Modify^Object^Hatch

    (1^ 1^ ), , - Hatch Edit ( ), . 16.27.

    /'. 16.27, Hatch Edit

    20001, Hatch Edit .

    !

    , , - Boundary Hatch, , . - : -, , Advanced(). , , , .

    ( . - ), . . AutoCAD H a t c h b o u n d a r y a s s o c i a t i v i t y removed( ).

    - . , , , -. S e l e c t o b j e c t s : - , Remove () . . -, , - , .

    16. 491

  • (). , O t h e r c o r n e r : ( :), , AutoCAD . - , . - , . , , .

    ( ) , F I L L . AutoCAD . -

  • () .05, Angle () 135.

    6. Pick Points ( ), 1, 2, 3 4 (. . 16.28). . Preview () - Boundary Hatch .

    7. , , S p e c i f ys t r e t c h p o i n t or [Base P o i n t / C o p y / U n d o / e X i t ] : ( [ ///]:) @0,-.0667

  • . 16.29. : , - . - (Bill Wynn), -,.

    Miil'iliiii> Styles? MuHne Style

    0 option

    Elwwnt ProptrtW ,.,

    . - Formats Multiline Style (1^ )

    Multiline Styles ( ), . 16.30.

    , . , AutoCAD - STANDARD(), , 1 . -: , .. , , .. , .

    , 16.30. Multiline Styles

    Name (),

    Element Properties ( ) Element Properties ( ), . 16.31.

    Elements () , .. - . Offset () - , . , -, . STANDARD - .5 , . . 16.32 - .

    494 .

  • Olhv Cdcr Llyct LAYER BY

    Puc, 16.31. ElementProperties

    -0,5

    . 1632. STANDARD

    J u s t i f i c a t i o n ().

    ' .

    1. Elements () . , . - , .

    , .

    2. Offset () . - , - , .

    , ,

    .

    " ' - >

    3. Color () .

    16. 495

  • 4. Linotype ( ) .

    5. Add (), - Delete ().

    6. Ele-ments () , . 2-4.

    7. Multiline Styles ( ),

    16 , - .

    Multiline Properties (

    ), . 16.33, - Multiline Properties( ).

    , . . 16.34.

    . 16.33. Multiline Properties

    Display joints

    Line,Angle - -90 Line,Angle = -45

    Outer arc

    Inner arc

    Fill () On () . - Color () -. Multiline Styles ( ).

    . 16.34. - Multiline Properties

    , ,

    . mln, Save (). - . 16.35 Save Multiline Styles ( ).

    496 //.

  • . 16.35. Save Multiline Styles

    acad. mln. , , Save() AutoCAD Multiline Styles ( ).

    , , -

    . Multiline Styles ( ) Load () Load MultilineStyles ( ), . 16.36. .

    - Multiline Styles. - .

    Multiline Styles - .

    . 16.36. Load Multiline Styles

    -g.dwg, - Drawings -.

    . 1. abl 6-g. dwg, -.

    2. . 16.37 - 6-8 .dwg AutoCad Bible .

    3. Multiline Styles, Format^MultilineStyle. Name () siteplan, Save.

    16. 497

  • . 16.37. -

    4. Element Properties ElementProperties. Offset 0. Color () , Linetype ( ) .

    5. Offset -132 (.. 11 , ); Color, -, Linetype .

    6. Add. Offset -180 (.. - 15 , ); Color, -, Linetype Center.

    7. Add. Offset -228 (.. - 19 , ). Color, -, Linetype .

    8. Add. Offset -360 (.. - 30 , ); Color, , Linetype .

    9. Add. Offset -480 (.. - 40 , ); Color, -, Linetype Center.

    ' . - acad.mln, . , , , _1.1.

    !

    10. Name () Save Multiline Styles ( ) acad.mln, .ml. Save ().

    11. Multiline Styles Load(), Load Multiline Styles ( - ). SITEPLAN .

    12. , - .

    498 //.

  • , --. , -. , , . Multiline Draw. - MLINE (), S p e c i f y s t a r tp o i n t or [ J u s t i f i c a t i o n / S c a l e / S T y l e ] : ( [//]:). . , S p e c i f y n e x t p o i n t : ( - :). S p e c i f y n e x t p o i n t or [Undo] : ( []:), S p e c i f y n e x t p o i n t or [Close/Undo] : ( [/]:). MLINE.

    J u s t i f i c a t i o n (). Z e r o (), ( ) Bot tom ( ).

    Zero. -. STANDARD, . . 16.38 - STANDARD.

    . , , - . . 16.38 - STANDARD.

    Bottom. , , , . 16,38 STANDARD. -

    S c a l e (), - - . , STANDARD 6 -, , 6 .

    STyle (). , ?

  • 3. Specify s t a r t p o i n t or [ J u s t i f i c a t i o n /Scale/STyle] : Snap From () - Object Snap ( ). _fromSpecify base p o i n t : ( :) 1, - . 16,39 ( , I n t e r s e c t i o n ()). : (.) @0,-10'
  • , , , - .

    AutoCAD - MLEDIT (). -, Modify^Object^Multiline(^), Multiline Edit Tools ( ), . 16.40.

    , . - , - .

    -. . AutoCAD , . MLEDIT , - .

    ^^0i^ AutoCAD , . . 16.41

    .

    . 16.40. Multiline Edit Tools

    . 16.41. -,

    . . AutoCAD , . MLEDIT , . . 16.42 - .

    , . 16.43 - .

    16. 501

  • . 16.42. ,

    , . , AutoCAD , . - - . . 16.44 .

    - .

    - , .

    .

    AutoCAD - , , , - . , , - , .

    . - AutoCAD {welding).

    AutoCAD . - .

    . 16.43.

    "

    abl6-h.dwg, - Drawings -.

    502 .

  • . 16.44. .

    . 1. abl6-h . dwg, -.

    2. abl6-9.dwg AutoCad Bible. . 16.45 , .

    1

    - 5

    , 6 -

    1

    4 1:! 2

    3 1 \i . . . .

    . 16.45.

    3. ModifyOObjeCt^Multiline - Multiline Edit Tools. DeleteVertex ( ) . , Multiline EditTools , .

    4. S e l e c t ml ine : ( ) - 1, .

    16. 503

  • 5. 2. - Speci fy s t r e t c h p o i n t or [Base point/Copy/Undo/eXit] :( , [ ///]:) 90 4'
  • SKETCH () , .. -

    . . () , -. , - . . 16.47 - , SKETCH.

    91

    92

    _

    - - - ^ ^ - - ^

    ^ ^ ^

    _- ~~ -.

    "

    (Note

    ~- -.

    \

    6)"----"^ - - --.

    \\

    92~ "- -----.

    . 16.47. , SKETCH

    SKETCH , . , , - PEDIT (). , - SKETCH, - SKPOLY: 0 , 1 .

    SKETCH sketch^ - :

    Reccrd increment :Sketch . Pen eXit Quit Record Erase Connect

    , .. . , . , . - (ORTHO) (SNAP).

  • 3. , . .

    4. , - ().

    5. -, .

    6.

  • . 16,48.

    1. ,

  • 0,0; 48,0, , , - .

    , , -, , . - , , -

    ' X Y. - . 31 .

    , . - . - , ( ) .

    , TABLET , , ON () OFF (). - - . - .

    . , , .

    - . .

    . 1. , a c a d . dwt.

    2. - 1 1 .dwg AutoCad Bible . . 16.49

    . 16.49.

    3. . 16.49 .

    4. Tools^Tablet^Calibrate (^^), :

    508 II.

  • D i g i t i z e p o i n t # 1 : 1 . 16.49Enter coord inates for p o i n t # 1 : 0,0
  • | 1

    ; ..." \I?

    " f-j_B

    R w

    - Z

    "* "

    *;**$!{**&.**

    j ^ "

    , -

    . , , . , -. - 1, , .

    AutoCAD 2000 layout() . AutoCAD -. - , ,

    - , ( ). , - , . , , .

    . - , - .

    , .

  • , , . , - , - . . , , 17 22 1. - , .

    (model space) -

    , , & , . AutoCAD Model -, . , - . , , - . .

    . , , , . , , . - () AutoCAD.

    \ 8, " ", , AutoCAD - .

    , AutoCAD, . , ( AutoCAD) . , .

    , .

    . -

    . AutoCAD

    ' 2. . .

    17. 511

  • Page Setup ( ), - . Cancel , AutoCAD , - , . . 17.1.

    1 -J

    \

    |2

    . 17.1. AutoCAD

    .

    , , Model.

    Layout Wizard Layout Wizard .

    , -, , .

    Layout Wizard .

    1. AutoCAD T o o l s ^ W i z a r d s ^ C r e a t e Layout (^). (. 17.2). , - .

    2. Name Next ().

    3. , . - , - , . , Next,

    512 II.

  • Create Layout - tteqin

    Puc. 17,2, Layout Wizard

    4. (. 17.3) , - . , Next.

    Create Layout. Panei Size

    Bean Select a we to be wed l she layouL Thepapw * need on the pkx device you teed'

    Puc. 17.3. Paper Size Layout Wizard

    5. . Portrait () Landscape (). , Next.

    6. Title Block (. 17.4) . - (, Block Xref). 18, " - ", 19, " ".

    AutoCAD , -

    AutoCAD (.. .dwg) \ T e m p l a t e s .*-!> AutoCAD

    , -, , Layout Wizard. ,a AutoCAD Title Block.

    17. 513

  • Creale Layout- lille Block

    " " 1 * . !. .* .

    *! -

    /*e. 77.4. Title Block Layout Wizard

    7. Define Viewports ( ), . 17.5, - .

    , None ().

    Single () .

    Std. 3D Engineering Views ( -) , . , . , - , , - , .

    Array () - .

    8. -. Next.

    5, " - ". , .

    9. Pick Location ( ) , , .

    10. Finish .

    . 17.6 2x2. - .

    Layout Wizard .

    514 II.

  • . 17.6. , - Layout Wizard

    abl7-a.dwg, - Drawings -.

    . Layout wizard

    1. abl7-a.dwg, -.

    2. 7 - 1 . dwg AutoCad Bible.

    3. Tools^Wizards-=>Create Layout.

    4. Begin Double -. Next.

    5. Printer , - . Next.

    6. Paper Size , - . (Inches). -, . Next.

    7. Orientation Landscape. ( , - .) Next.

    8. Title Block ANSI A title block.dwg. Block. Next.

    9. Define Viewports Array. Rows ()1, Columns () 2 . Viewport Scale ( ) Scaled to Fit ( - ). Next.

    10. Pick Location Select Location ( ). Auto-CAD , (

    17. 515

  • ). , . "" , .

    11. Finish.

    12. . AutoCAD , . 17.7.

    I " I

    * t > .. U-oull XDouble/ 'hi. 17.7. , Layout Wizard, -

    , , -

    Layout Wizard, . , , .

    AutoCAD 256 . -

    ( Model), , . 17.8.

    .

    New layout ( ). .

    From template ( ). Se-lect File, AutoCAD .dwg .dwt. , Open. Insert Layout(s) . - AutoCAD ,

    flew leyuiFrom Jempli

    BettemeHove or CopySelect ftlUswiKb

    . I 7.8. - Layout

    516 II.

  • , , , .. ( ).

    ^ , AutoCAD , .. - 4 PURGE.

    11, " - , , ".

    Delete (). . AutoCAD - - . - .

    Rename (). Rename Layout, . , , - .

    Move or Copy ( ). Move or. , ( ) . Move or Copy, . Create a copy. . -, .

    Select All Layouts ( ). - . -, .

    Page Setup ( ). Page Setup, - .

    Plot (). Plot, .

    Page Setup ( ) AutoCAD

    Page Setup (. 17.9). Display when creatinga new layout, , Page Setup ( ). Layout Settings ( ) - , Layout Wizard.

    Page Setup, AutoCAD , Options ( Tools^Options) Display Show Page Setup dialog box for new layouts( Page Setup ).

    Page Setup AutoCAD , - Page Setup Windows. AutoCAD - . , , MOiyr . . AutoCAD . , , .

    17. 517

  • |[|
  • Plot options ( ). Plot objectlineweights , , . Plot with plot styles( ) , , . ( .) Plot paper space last ( ) , , ( , -, ..). Hide objects () , , - , ( , - , ).

    Plot Device , -. Plot, - .

    Page Setup. , -, , . .

    . , Page Setup.

    1. .

    2. Add () . AutoCAD User Defined P a g e Setups (, ).

    3. New page setup name .

    4. .

    PSETUPIN, . AutoCAD Select File, , - . , Import userdefined page setup(s) . .

    2, AutoCAD. - pcinwizard

  • . , . , - , . , , -, , .

    . -

    AutoCAD . .

    , , , . ( ) , - . , - .

    .

    , , .

    , , "". .

    , , , .

    - . - , , .. .

    .

    View Viewports ( ); , .

    Named Viewports ( ). - , - Viewports. Named View-ports ,

    , \ - 9, ": ".(

    New Viewports ( ). - Viewports (. 17.10). -. , - . .

    1 Viewport (1 ). AutoCAD Specify c o r n e r ofv i e w p o r t or [ O N / O F F / F i t / H i d e p l o t / L o c k / O b j e c t / P o l y g o n a l /

    520 II.

  • Restore/2/3/4] < F i t > : ( [////////2/3/4] :). - Fit (), , .

    "hie' 1-J*

    SingleTwo Vertical

    Two. Horizontal

    Three. LeftThree" AboveThree: BelowThree- VerticalThree: HorizontalFour- Equal

    Viewport S R B 4

    \ W a :

    , .kit. [

    . 17.10. Viewports

    2 Viewports (2 ). -, -. - F i t () . .

    3 Viewports (3 ). , - . F i t . - .

    4 Viewports (4 ). . - F i t . - .

    Polygonal Viewport ( ). . , , - . .

    Object (). , (, ).

    , - . , .

    17. 521

  • .

    , . .

    PAPER . ( MODEL.) , - .

    , .

    . . - . .

    -

    . .

    Zoom () Zoom Scale ( ). - ZOOM(). , , 1:48, 1/48

  • . , , - , " " .

    5. Specify p o i n t in v iewport to be panned:( , :) , - ( Horizontal, -, Vertical, ).

    6. AutoCAD , .

    AutoCAD . , , .

    MVSETUP , . Align, - Rotate.

    MODEL () -

    . , . - , STRETCH () MOVE ().

    VPCLIP : - , - .

    - . vpclip. S e l e c t c l i p p i n g o b j e c t or [Polygonal/Dele te]: ( [/] < ->:) , . . - . - -, Delete () . , , , Polygonal.

    . , - , . - . Properties, - , . On - No.

    . : ( , -

    ) Display Viewport Ob-jects&No ( ^). - , , Display Viewport Objects oYes ( ^).

    17. 523

  • -

    , , , . - . , . Layer () Object Properties ( ). Layer Properties Manager , , Ac-tive VP Freeze ( ). . () .

    2000i, Layer Control () Freeze (in current viewport) ( - ) Thraw (in current viewport) ( -

    ! ). , , - Layer Properties Manager ( ).

    -. Layer Properties Manager New VP Freeze ( ). , . , .

    : " / "(p!ottable/not plottable). , , , - . 11, " , , ".

    (.. , - HIDE), , . - Properties Properties Hide plot. - Yes ( ). .

    (, ..) , ,

    . , , .. , . . , , - TEXT () ().

    AutoCAD 2002 (trans-spatial dimensioning). - ,

    ! -, . .

    524 II.

  • , - . .

    , - 1:1.

    , .

    . - , .

    - . ~* , -"' " -~ . , -

    ! , , - DIMREGEN.

    , , , - . .

    1. Dimension Style Manager ( ).

    2. Modify ().

    3. Fit () Scale dimen-sions to layout (paper space) ( - ( )).

    4. .

    , , , .

    ^^** , AutoCAD, .

    i , DIMASSOC 2. , , D I M R E A S S O C I A T E . 14, " ".

    , -

    . .

    1. layout^.

    2. AutoCAD Save as ( ) .

    3. Enter l a y o u t to save to t e m p l a t e :( , :) - ( - ). , - .

    4. AutoCAD Create Drawing File, - Template. Save as type Drawing TemplateFile (*.dwt) ( ). Save.

    17. 525

  • , - From template. .

    , .

    abl7-a.dwg ab-a-blk. dwg, Drawings -.

    . 1. afc>17-a.dwg, -.

    2. 7 - 2 .dwg AutoCad Bible .

    3. Layout 1. Page Setup. ( -, Page Setup .)

    4. Layout Settings Paper size ( ) Letter(, 8.5x11 ). . .

    5. , - ( ). , Erase() Modify (), - .

    6. Layer ( Object Properties). T i t l e b l k .

    7. Insert^Block (1^ ). AutoCAD Insert (). Browse (). - ab-a-blk.dwg - Open. Insertion Point ( ) - Specify On-Screen ( ). . AutoCAD , . 17.11.

    . 17.11. , -

    526 II.

  • 8. .

    9. View1^Viewports^1 Viewport (^ =>1). Speci fy c o r n e r of v iewport or[ON/OFF/Fit/Hideplot/Lock/Object/Polygonal/Restore/2/3/4]< F i t > : ( [// / / // / /2/3/4] :) 1, - . 17.11. Speci fy o p p o s i t e c o r n e r :( :) 2.

    10. Repeat 1 Viewport . 3, 4. 5 6. , .

    11. Properties () , , Custom scale (, ). 4. . - , , .

    12. . Standard Scale( ). 2:1.

    13. - , - (. 17.12).

    . 17.12. ,

    14. . LayerControl ( ), Object Prop-erties ( ). DIM HATCH ( -), . - DIM-PS, . ,S t y l e 1, .

    15. . ( - , .)

    17. 527

  • Dimension^Linear (^). Quadrant() . - , 1/2.

    16. Layer Control Text. Layer Control. ( ), . Layer Control.

    17. Draw^Text 1^ Single Line Text (^^- ). , . 17.12.

    18. .

    PTLTSCALE -1 . -

    1. , - . 0 P T L T S C A L E , ( , ). , LTSCALE ( ). - PTLTSCALE - REGEN () - .

    I

    AutoCAD, ,

    . , , , -, (.. , ByLayer). , , - . , - , , , . , , .. , . , AutoCAD - , .

    - . AutoCAD - .

    , . . - .

    1. .

    2. .

    3. .

    4. .

    528 //.

  • .

    , .

    AutoCAD (color-dependent plot styles). . c tb, , . , .

    (named plot styles) - , . s tb . - .

    Options Plotting( ), . 17.13. Tools^Options (^). Default plot style behavior fornew drawings ( ) Use colordependent plot styles ( , ), Use named plotStyles ( ).

    EtonFin j Deploy) OpenarelSewi

    UseetdefauioutputdesiceDesUel 81 Series Printer

    P Uiecofct dependent ptol^fet

    Uwosmedptotttl*B,,- .-'".

    G crmal pfct option

    When chengngtbef** device:

    *"* Ue (he pk* device papa

    Syiiem (* spool tort

    [Always alert (and log errors)

    OLEpfctauaBjr :

    text documerJ]

    - , \ ^ fa(hecummlai

  • !

    , AutoCAD 2002, , , , , - . ( - ). , , . , 30, " - ".

    Normal.

    . . 17.14 Normal ( Table View - Plot Style Table Editor). Normal "", .

    \ Hot Style I able Lilitor - acaiUtli

    X t }

    Virtual pen*,*

    BlackUse obiect coloi

    F P

    Automatic AutomaticAutomatic Automate

    100 100Use rbiect linetyoe Use obiect inelype

    W P0 OOOQ mm U se obiect Ineweght'

    U j j n 1

    Use obiect end style . U object end style -**

    Use object pin style Use object join style '

    Use obiect fil style Use obiect fill style [t-

    . 17.14. Normal , - AutoCAD no

    . , - .

    Acad2002\Plot s t y l e s . , ,

    (- 2-) , 14 (acadr l4 . cfg). , " ".

    530 II.

  • Add Plot Style Table ( -

    ). .

    File^Plot Style Manager (^ ) ACAD2002\Plot S t y l e s . Add Plot Style Table wizard. , .

    Tools'^ Wizards^ Add Plot Style Table (=>^ ).

    .

    1. Next .

    2. Begin (. 17.15) , - . ( Start from scratch), - ( Use an existing plotstyle table). , - a c a d r l 4 . cf g 14, Use My R14 Plotter Configuration (CFG). - , Use PCP or PC2 configura-tion file. Next.

    --i BI

    I I V 1

    "*-

    . 17.15. Begin Add Plot Style Table

    3. , . - - , . Next.

    4. File Name . Next.

    5. . , Usethis plot style table for new and pre-AutoCAD 2000 drawings ( - ). -

    17. 531

  • , . , . Plot Style Table Editor, - . , , -, . Finish.

    ,

    AutoCAD ( AutoCAD 2000) - . - . AutoCAD 2002, -. , , Begin Use an existing plot style table. Pick Plot Style Table ( ) Next. AutoCAD -, - 255 . .

    .

    ,

    , , , . .

    Finish Add Plot Style Table Plot Style TableEditor .

    AutoCAD File^Plot Style Manager - STB- .

    Plot style table PlotDevice Page Setup ( ) - Plot ( ), Edit.

    Select Plot Style ( ) Editor ( LayerProperties Manager, Plot Style).

    Tools Opt ions Plotting. Addor Edit Plot Style Tables ( ).

    . 17.14 Table View () Plot StyleTable Editor. Form View () . 17.16. - . Form View . Table View - . Add Style. AutoCAD S t y l e l ( ). , , - , .

    , . , & .

    532 II.

  • IDaPtol Style Table Editor acdil.stbGenaalj *

    stories:fJurnial

    Black

    View FonttVww

    d

    d

    | Delete Slste [ -

    l ^ * * jDUseobiectcolof

    Uw; j O n

    ... ; .. i'W*c*e. Jon'

    ""^tW* j Use obiecl linetype

    WWW>* j OOOOOmm

    U W ^ d t ^ K ] Uieobiect end style

    urejtmtete j j Use ob,ecl win ityle

    . ** j Use obiect fll style

    d i , -

    Lil

    d j

    l i .

    d j j

    s i !

    d :

    d :

    d .

    - 1

    d 1

    d

    , j

    !

    . 17.16, Form View PlotStyle Table Editor

    , - ,. .

    . . , - . .

    Color. , ObjectColor ( ). , , - .

    Screening. ( ). - 0 ( , .. ) 100 ( ). , , -. , - 50.

    Dithering. -. . - , . - - .

    Grayscale. , .

    Pen # and virtual pen#. (virtual pen# ,

    17. 533

  • ). , . -, Color Object Color - , .

    U Linetype. , Object Linetype ( ). , , , .

    Adaptive. , On, - . - , Off.

    Lineweight. , Object Lineweight ( ). , - , .

    Line end style. , - , . Butt(), Square (), Round () Diamond (). - Object End Style ( , ). , - Form View.

    Line join. . miter ( ), bevel ( -), round (), diamond (). Object Join Style ( , ). , Form View.

    Line fill style. , : solid(), checkerboard ( ), Crosshatch (-), diamonds( ), horizontal bars ( ), slant left( ), slant right ( - ), square dots ( ) vertical bar ( ). Object Fill Style ( , ). , Form View.

    AutoCAD 2000i . RGB (Red-Green-Blue) - Hue, Saturation, Value. , no-

    ! , .

    , , - Color , . .

    1. Color (), . - True color , - True Color, . 17.17.

    2. , .

    534 //.

  • ' Color Dialnn

    . 17.17. True Color

    , , - . , , , . , .

    Red (), Green () Blue(). , .

    Hue (), Saturation () alue (). , - .

    AutoCAD . , Original ().

    3. , .

    4. Save&Close ( ).

    , Delete (). , Save&Close.

    ( ) - , . , Model.

    , - .

    .

    1. .

    2. Page Setup .

    3. Plot Device ( ) - Page Setup.

    17. 535

  • 4. Plot style table .

    5. , , Display plot styles.

    6. .

    , .

    - . - Page Setup . Plot Device Page Setup Displayplot styles ( ) Plot style table. . ( , , - REGENALL.)

    . Plot Full Preview.

    plot style , , ,

    , , - .

    , - ( Model), .

    .

    1. , .

    2. Layers Object Properties - Layer Properties Manager.

    3. Plot Style .

    4. Active plot style table - .

    5. Select Plot Style.

    6. .

    Page Setup Display plot styles, , , . , r e g e n a l l .

    Properties, Properties. He , . Plot Style .

    abl7-b.dwg, - Drawings -.

    536 II.

  • . 1. , , -

    ToolsOOptions Options Plotting. -, DefaultPlot Style Behavior for New Drawings. , - , AutoCAD.

    2. Use named plot styles ( ) - .

    3. abl7-b.dwg, -. 14.

    4. 7 - 3 .dwg AutoCad Bible .

    5. Tools^Wizards^Add Plot Style Table (1^' ). Next .

    6. Begin Start from Scratch ( ) Next. Named PlotStyle Table ( ). Next. File Name 7-3 Next. Finish Finish. (He Use for new and pre-AutoCAD 2000 drawings ( ), .)

    7. File^Plot Style Manager. ( - , , - .) 7 - 3 . s t b .

    8. General - AutoCAD Bible.

    9. Table View. Add Style (). S t y l e l . Blackcolor .

    10. Color Black color Black. Save and Close. P l o t S t y l e s .

    11. Layouti, Plot Device PageSetup - 3 . s t b Plot style table. Displayplot styles . - Layout i .

    12. Layers Object Properties. Layer PropertiesManager A-DETL-PATT ( , ). Plot styles Select Plot Style (. 17.18). Black color . A-DETL-PATT Plot Style Black color. Layer Properties Manager.

    13. regenall

  • plSelect Plot Stvie14. Properties ( ) Properties.

    15. PAPER .

    16. - .

    17. Plot Style ( -) Properties. - Black color.

    18. . - .

    19. Tools Options. Plot-ting () Options - Default Plot Style Puc ]7_]8. Se-Behavior for New Drawings , feet Plot style - . -

    ?-

    .

    a b l 7 - 3 . s t b Results -.

    . , -

    , , , . .

    .

    , Plot () -1 . Plot, . 17.19 Plot Settings ( ). , Layout Settings ( ) - Page Setup ( ).

    ( ) Layout Settings Page Setup , - ( ) Plot Settings . . AutoCAD 2002 , .

    538 II.

  • Fasv we end papa intt

    -I at. -

    J M I w r . m

    FulPteviefl. Mal Preview..

    . 17.19. Plot Settings Plot

    , Page setup name. , - , Save changes to layout( ). . , - . Page Setup, .

    , , Plot Device (

    ), . 17.20. . -

    , Windows Start^Settings^Pdnters Add a Printer. , , , - Add Plotter wizard. ( AutoCAD Tools^Wizards^Add Plotter (^1^ ).)

    Windows , , Windows Plot Page Setup. , . , , Tools^Options(^>) Plotting () . Hide System Printers ( ), .

    !

    17. 539

  • Lajiooinflme -=e change to ia/out

    ~ Page se*jji - - -

    BDevicePtotier

    Hjits.

    ^ - - "- -

    Whetlo'plo PWtofc FWwfte

    Nune oi cnpwr

    1 Ea*d Preview.. Me*

    /*,-. /7.20. Plot Device Plot

    , Plot Style ( ).

    What to plot ( ) AutoCAD ( All layout tabs), - ( Selected tabs), ( Current tab). Currenttab, Model .

    What to plot Number of copies.

    , - Plot to file. File name, - AutoCAD , "" Auto-CAD. , Location. Location .

    AutoCAD 2000i - , . .

    !

    , , Properties () Plotter Configuration ( ) - Plot Device ( ). ( , .)

    Plotter Configuration Editor Device and Document Settings ( ). "-+", ITC Graphics. Merge Control ( ), -

    540 II.

  • . ( Plotter ConfigurationEditor .)

    Merge Control Lines Overwrite ( ), LinesMerge ( ) .

    AutoCAD : - -, -. .

    , Plot, - Plotter Configuration Editor, :

    P l o t t e r C o i i l i m i f a t i o n L d i t o r 0(1

    V 4 ' 9800

    (& Media

    I B Media Type W Graphics

    Qf Cuslom Piopertei 3*[ Utep-detined Papei Srat t. Calbiation

    t i J Custom Papei Siies

    l^a Mad*ySt*idardPapeiSrai|PnntableArea)

    j j Filter Pep Sees

    .F

    -'*'. Sfee- '.:s

  • , ,

    . , , Full Preview ( ). . 17.21 - .

    . 17.21.

    (Partial Preview) , . 17.22.

    . 17.22. -

    , , . ,, , . , - .

    542 //.

  • Print Preview( ), , Windows. - - . , - , , - .

    , -

    . , .

    Plot ().

    "Stmplot , , Plot. \sof tware\Chapl7\Stmpiot.

    (Batch Plot Utility BPU) -

    . , .

    , - . 2 -, . .

    BPU Auto-CAD, . - AutoCAD .

    BPU Windows Star t^Programs 1 ^AutoCAD 2 0 0 2 ^ ^ Plot Utility. AutoCAD . 17.23 AutoCAD Batch Plot Utility ( - AutoCAD).

    | ' | Add Drawing File ( )dsE] Add Drawing ( ) BPU. - , Open (). - , . - , , , - , . - .

    ; , * -, Save List ( ) BPU. - (, A C A D 2 0 0 0 \ S u p p o r t \ B a t c h p l t ) , .

    17. 543

  • AutoCAD Bdlch Plot UlililyOptions Help '

    DrawngFJ Ph I FtatPavt

    . 17.23. AutoCAD Batch Plot Utility

    , Open List( ) .

    Remove ().

    , ,

    . Layout () Layouts (. 17.24). Plot all layouts ( ), Plot selected layouts( ). . Show all layouts ( -) .

    . BPU Layouts, "Multiple" (). - .

    . -

    Page Setup PageSetups (. 17.25).

    Page Setups . , . , Page Setups. , Open.

    544 //.

  • al.UI *..lwi| 31

    /*MC. /7.24. Layouts ,

    /. /7.^J. Page Set-ups - , - -

    -

    (, , -). , BPU: ( PlotDevice) ( - Plot Devices . 17.26).

    - ( . ). Browse - Open.

    . 17.26. Plot Devices ,

    % Plot Devices

    HP LaserJet 4Si MXAchveTouch Document LoaderDWF ePIot (optimized for plotting) DWF eView [optmjed lor viewing] PubtatTbWebDWFpc3PublishroWebJPCipc3PublshToWebFtiG.pc3

    I ? Show pfet device

    P o p t i o n .

    Oelault plot ccrtigustim for selected d e

    Canal tiefc

    Plot Devices BPU -

    . AutoCAD Page Setup. , , Cancel. Plot Settings (. 17.27).

    Plot Settings , . Layout Settings Page Setup Plot. , Layers, . 17.28.

    17. 545

  • ! Sr ' l l i i i i l - . l i

    Puc. 17,27. Plot Settings -

    h f c l ' M I S H I i i i i i s l i . i l w i l

    -

    e~' _

    Lava NameDEFPCINTSBLDGDIMDETAILSSITEDIMELEVSCALE

    iPkftngQn/COnOffOnOnnOnOnOn

    1 |

    *

    f

    11 ' ,"*.,.

    1 '" 'i 1

    i 2" 11 *

    j 1 fj 08 1 J

    : . . . _ ,

    -

    OK, Concei Help

    Puc, 17.28. Layers Plot Settings -

    , . Layer Layers BPU - - ,

    BPU - .

    w j 1 Plot Test ( ) BPU. -

    , . - ,

    - , .

    WARNING: Xref f i l e not a c c e s s i b l e , xref checkingcannot be v e r i f i e d

    , , , .

    546 II.

  • Logging ( ) BPU -

    . , . , 2 .

    Logging - BPU, Logging, . 17.29, Enable journal logging

    ( ) . - AutoCAD2002\Support\Batchpl t\Bpjournl . log, , . , Overwrite. - . Ap-pend. Header and Comment ( ) , - -, , , .

    Enable error logging ( ) . , . .

    ] Dim*** ,,. . 4* />* ~ ; I ' . V^' ;.5 _

    . 17.29. Logging

    .

    , Plot. -, , - . - , . Close () BPU AutoCAD.

    AutoCAD - - Batch Plot Utility. .

    AutoCAD - , , , , BPU. , ( , , , ). Page Setup, , . , Showpage setup dialog for new layouts Display Options ( Tools Options).

    17. 547

  • .

    . p l o t s t a m p , Plot Stamp. , - , .

    f P L O T S T A M P , AutoCAD 2000I. - Batch Plot Utility,

    s 4 i .< !

    , Add/Edit(/) User Defined Fields (, -). , , Add, Edit.

    Plot Stamp Parameter ( ) - .pss-. .pss-, AutoCAD: i n c h e s , ps s mm. pss .

    , inches.pss - ,

    ! AUtoCAD\Support. - Properties (). Properties Read-only . .

    , , - Advanced (), - Plot Stamp. , , .

    On Plot Stamp Plot Device Plot (). Settings () , Plot Stamp. , .

    .

    , . AutoCAD .

    548 //.

  • .

    . 18 -, . 19 , . , 20 , .

  • >q ' .. ^

    ^ ^ '

    t J BTOrffiVoW *">5*

    - .

    , . - - . - , , - .. - AutoCAD . , - -, AutoCAD , , . , -, , . - .

    - . , .

    , . , - . , , .

    T R I M ( ) E X T E N D

    () .

    !

    , . - AutoCAD - . .

    AutoCAD -

  • . , . -, - .

    .

    . -

    , - , . , , -, ,

    . 18.1 . -

    , . - , , . , . - . , , , .. . - .

    \

    -

    - -

    government land corner...found or set

    highway R.O.W. rail point set by previous survey set temporary point- - s e t 1/2" rebar with #10568 s e t asphalt nail set railroad spike existing fence corner post exis t ing f e n c e line

    . 18.1. . -

    . , . . 18.2 ( ). 0,0. . , , .

    , , -

    . , , . (, - , .) .

    18. 551

  • -^

    . IS.2.

    1. Make Block ( ) Draw(). (), Block Definition ( ), . 18.3. .

    552

    . 18.3. Block Definition

    2. Block name ( ) (255 , ).

    3. Select Objects ( ). . , ( , ). , , Block Definition ( ). ( , - . - .) 10," ", Quick Select.

    III.

  • 4. . 0,0 ( 0,0,0 ). , , - , Pick Point(). S p e c i f y i n s e r t i o n b a s e p o i n t : ( :) .

    J53-. ^ s . , , ,

    From () 44v W-"~7 (Tracking) .

    5. , , Retain ( ). -. , Delete (). Convertto block ( ).

    6. AutoCAD . AutoCAD DesignCenter - , , - . -, Do not include an icon (He ).

    7. Insert Units ( ) , - ( , - ). , , . , - . , . , U n i t l e s s ().

    8. . - AutoCAD DesignCenter.

    9. , .

    , , - Delete ( ), . AutoCAD OOPS (). - , ERASE (), , . , UNDO , , .

    , - , , , -

    PURGE ().

    , , , -

    .

    18. 553

  • - , . , UNDO () - . , . ( .) , . - . Yes. , - , AutoCAD -. . , - , - .

    abl8~a.dwg, - Drawings -.

    . 1. 8- . dwg -.

    2. 8 - 1 .dwg AutoCAD Bible . , . 18.4. ( OSNAP () ) Endpoint (), Quadrant () Intersection ().

    i .4.

    5,

    6.

    7.

    . 18.4.

    1,5 , Make Block ( ) Draw ().

    Name ( ) Block Definition ( ) 1-5 amp fuse.

    Select Objects ( ), - .

    , . 18.4: , . , - . Select Objects 6 o b j e c t ss e l e c t e d ( 6 ). , Make Block ( ).

    Pick Point () Base Point ( ) - .

    554 III.

  • 8. - Q u a d r a n t (), - 1.

    9. Delete ( ). - Create Icon from Block Geometry( ). Insert Units ( ) Unitless (). De-scription () . , ., , .

    10. , , Make Block Draw Block Definition Name - (. 18.5). .

    11. .

    IfjUloikDi'linilmt.

    5 Name Block Definition -

    , AutoCAD 2002 ( AutoCAD 2000), ,

    , . - AutoCAD DesignCenter - . , - - , , , , . , - .

    , .

    1. wblock

  • fffiWtile lllock S a u c e

    P Block."

    ***;

    "*\1

    .

    name,

    t,ocwre ,/

    -

    Jl-5 amp hiJH

    ]Umtle:s- 1___ || Caned

    r1':

    H # 1

    /"MC. /^.6. Write Block -

    4. File Name , . , .

    5. Location () , - .

    6. Insert Units ( ) Unitless ().

    7. , .

    , , BASE () . -

    0,0,0. -\\ , .

    WBLOCK () XML-. XML- . FileName ( ) Write Block ( ) - . x m l . XML- 27, " ".

    !

    WBLOCK () , . WBLOCK , -. , . - . Yes ().

    , Create Drawing File ( ). , - . Save ().

    556 III.

  • abl8-b.dwg, - Drawings -.

    . 1. abl8-b.dwg -,

    2. 8 - 2 .dwg AutoCAD Bible . , . 18.7. (OSNAP ) Endpoint.

    . 18.7,

    3. wblock

  • 10. oops
  • 18.9. Insert

    3. ipynnax Insertion point ( ), Scale () Rotation () - Specify On-Screen ( ), . Specify On-Screen , - , .

    4. Explode (), - , .

    5. , Insert ().

    6. Specify On-Screen ( ) ipynnc, AutoCAD .

    S p e c i f y i n s e r t i o n p o i n t : ( :). AutoCAD - , . , "" .

    E n t e r X s c a l e f a c t o r or s p e c i f y o p p o s i t ec o r n e r : ( X :) ( 1) , - , . S p e c i f y o p p o s i t e c o r n e r ( ) - , X. 1, 1. , X, AutoCAD - Y. , - .

    Speci f r o t a t i o n a n g l e : ( :) . : . . - .

    , AutoCAD - .

    18. 559

  • - . X, Y. Y, X. . 18.10 . 0. - , . , - . . .

    X = -1 X = 1 Y = -1 Y = 1

    X = -1 X = 1 Y = 1 Y = -1

    . 18.10. , -

    XML- Insert (). XML-, Browse (), - Open (). ,

    ! . ( XML- 27, " ".)

    , , . , , . AutoCAD DesignCenter.

    AutoCAD DesignCenter (.. , )

    AutoCAD DesignCenter. AutoCAD DesignCenter . , . , " + " . ( ) . Preview, , - . Description , . .

    AutoCAD Insert. , , .

    560 III.

  • "" . AutoCAD , . , AutoCAD .

    AutoCAD DesignCenter . , AutoCAD DesignCenter, . , AutoCAD INSERT, - , , .

    DesignCenter Close .

    - . , , , - . INSERT ( -insert), - S p e c i f y i n s e r t i o n p o i n tor [Scale/X/Y/Z/Rotate/PScale/PX/PY/PZ/PRotate]: ( [/'///////]:). -, . - , . .

    Scale ()

    ()

    *Z(Z)Rotate ()PScale

    ()

    PXscale()

    PYscale()

    PZscale()

    PRotate()

    X

    Y

    Z

    , - , -

    X, , -

    Y, , - Z, , -

    , - ,

    1$. 561

  • , Symbol Libraries ( ) AutoCAD Today. - 26, " ".

    abl4-b.dwg abis-c.dwg, Drawings --.

    . 1. 8 - . dwg -.

    2. ablB-3 .dwg AutoCAD Bib le . - (. 18.11). . ( OSNAP ) Endpoint Midpoint. Door ().

    . 18.11.

    3. Zoom Window ( ), - .

    JZ\ 4. Insert Block () Draw (). -JPL Name Insert () DOOR ().

    Specify On-Screen ( ) . Insert .

    , , Undo ()

    ^ . - . Erase () Modify ().

    5. . - I X Y - . :

    Specify insertion point: Endpoint, 1 (. . 18.11)

    562 III.

  • Enter X scale factor or specify opposite corner : -1
  • AutoCAD DesignCenter , Tree View Toggle ( ) DesignCenter,) -. - -, a b l 4 - b . d w g . B l o c k s . , .

    14. TOILET2. DesignCenter . ( , Preview ( ) .) - AutoCAD Insert. , , . . Specify On-Screen( ) Insertion Point ( ) -, . Specify On-Screen - . .

    15. , ( ). AutoCAD DesignCenter - AutoCAD DesignCenter AutoCAD, Close AutoCAD DesignCenter.

    16. Zoom Extents ( ), - . .

    AutoCAD MINSERT (), . MINSERT

  • 18.1.

    ( 0}, , ByLayer

    ( 0), , - ,

    ( 0), , - , B y B l o c k

    0 ( , B y B l o c k ByLayer)

    , - , , . , , , . , , , Properties , - , . , Properties ,

    , - . , , -

    . - , AutoCAD , , .

    : , B y B l o c k -, ( ) -, C o n t i n u o u s ()

    , -. ,

    , , - , . . 18.1, - ( ByBlock 0) - -, . , , .

    0 . , , - . , .

    abl8-d.dwg, - Drawings -.

    . 1. a b l 8 - d . dwg -.

    2. 8-4 .dwg AutoCAD Bible. - , . 18.12. ( OSNAP () ) Endpofnt, Quadrant, Intersection Midpoint.

    18. 565

  • AIR DAMPER SW(LOCATED

    H - L

    INSIDE

    O-. O*

    FAN HOITCHJSING)

    GRY

    BRN

    MIT SWTCH(BURNER HOUSING)

    BRN

    ORG/BLK

    4

    1 1. 18.12. ,

    3. Make Block ( ) Draw(). Block name ( ) BlockDefinition ( ) hi switch. SelectObjects ( ). , - (HI-LIMIT SWITCH). He -. . Pick Point () Base Point ( ) . - Quadrant 1 (. . 18.12). Retain ( -) . . O b j e c t , C o n t i n u o u s (). , ByLayer,

    4. (AIR DAMPERSWITCH) , . ( - O b j e c t , C o n t i n u o u s . ) Color Control ( ) ByBlock, . - ( , ). .

    5. Make Block Draw. Name - ad switch. : 4 ob j e c t s selected(BbmcjieHO 4 ), Pick Point. , . ,

    6. , 2 . ( C o n d u i t ( ), H i d d e n 2 (2),) Make

    566 III.

  • Block Draw. Name top conduit. , . Pick Point. , 3. . H i d d e n 2 .

    7. , 4 - . ( C o n d u i t ( ), Hidden2.) LayerControl ( ) 0. Make Block - Draw. Name bot conduit, , . Pick Point. - , 5. . C o n t i n u o u s ().

    8. . New () -. Create Drawings AutoCAD Today Start from Scratch ( ). - English (). . . 0. ( , - Layer Control.)

    9. AutoCAD DesignCenter. AutoCAD B i b l e 8 -4 . dwg. , B l o c k s . , . - h i s w i t c h . AutoCAD Insert. Specify On-screen Insertion Point Scale. . , - 3. O b j e c t - (), , "" 0. , Layer,

    10. Layer. Ob j e c t , - , .

    11. t o p c o n d u i t DesignCenter. Insert . -, , 3. - ( H i d d e n 2 ) , "" - 0. , Layer C o n d u i t .

    12. Layers Object Properties - Layer Properties Manager New. He , 4 Cyan (). Current (), .

    13. DesignCenter ads w i t c h . Insert . , , 3. O b j e c t , (, ) ByBlock. 4 "" .

    18. 567

  • 14. b o t condui t , - 0, 4 "" .

    15. Close DesignCenter. He .

    rjpp . . , , . , Explode () - Modify (), AutoCAD EXPLODE(). ( .) , , , , ( , , , ) . ( - IV, " ".) - , . - , .

    , 0 BYBLOCK, - , , Continuous .

    X Y, . , , , 1 X 2 Y, -. .

    XPLODE XPLODE () EXPLODE (), -

    , , . , , .. , .

    , xplode

  • abl8-e.dwg, - Drawings -.

    . EXPLODE XPLODE1. 8 - .dwg -.

    2. 8-5 .dwg AutoCAD Bible. , , - , (. 18.13). ( OSNAP ) - Endpoint, Intersection, Quadrant Midpoint. Object.

    AIR PAMPER SWITCH(LOCATED INSIDE FAN HOUSING)

    1 . , GRY

    BRN

    HI-LIMIT SWITCH(BURNER HOUSING)

    t t

    BRN

    ORG/BLK

    . 18.13.

    3. Explode () Modify(). S e l e c t o b j e c t s : ( :) (AIR DAMPER SWITCH), - 1 . 18.13. , , ( , ), , ByBlock.

    4. Undo () .

    5. xplode

  • 7. xplode^. , , hidden2 ( ). , 0. :

    Select objects: 3 4. 2 objects found.Enter an option [Individually/Globally] :

  • ! * - " " - "+\ " " " *

    . 18.34. . . (Sid Herbage) (, )

    . ( - . 19, " ".) , , . .

    1. Insert Block.

    2. Browse.

    3. , , Open. ( - , , .)

    4. AutoCAD , , . Yes.

    5. , .

    . - AutoCAD DesignCenter, , .

    . .

    , . , , - . QTEXT () (. 13, " ".).

    ., . . , .

    18. 571

  • .

    , .

    1. -insert^ .2. : =.

    , Auto-CAD, . .

    ^0** , ^ AutoCAD, Tools Options (^)

    Files (). Support File SearchPath ( ), Add () , , Browse (). , - Options, .

    3. , . -

  • 4. DesignCenter.

    5. Insert .

    , . . Node ().

    . , , Windows. , , , , , . , .

    . - , . , . -, - .

    , - .

    -

    -, , , -, , .

    3 d t r e e s . - 8 \ S o f t w a r e \ C h a p l 8 \ 3 d t r e e s .

    A c a d a r t 87 . , - , - . \ S o f t w a r e \ C h a p l 8 \ A c a d a r t .

    Acadsym . - \Software\Chapl8\Acadsym.

    EpdxfOOl 48 DXF- - . DXF-, AutoCAD, - Open () , Files of type ( ) DXF (* . d x f ) , - . Open (). \ S o f t w a r e \ C h a p l 8 \ E p d x f 0 0 1 .

    Furn-symbol , . \Sof t w a r e \ c h a p l 8 \ F u r n - s y m b o l .

    F u r n 2 19 , - , . \Software\Chapl8\Furn2.

    L i b e l t r \ S o f t w a r e \ C h a p l 8 \ L i b e l t r .

    MPE-arch , - , . Mpe.dwg

    18. 573

  • . - \Software\Chapl8\Mpe-arch.

    Pipesyml Pipesym2 - . Pipesym2 Pleg.dwg, - . \Software\Chapl8\Pipesyml Pipesym2.

    screwit , 32 , . \Software\Chapl8\Screwit.

    Treepla l 11 , . \Sof tware\Chapl8\Treeplal.

    Windows

    , , - Clipart. . , Windows - . : , - , . AutoCAD. , .

    Windows

    , , , - Windows . . 18.2 -, (CUTCLIP (), COPYCLIP() PASTECLIP ()).

    [ 18.2. _ "~~ ;-

    MOVE () ;

    C O P Y ( )

    () ; ;WRI ( ; -

    1 ; ( ).I N S E R T () AutoCAD DesignCenter

    () ( * (1 ); ,

    1 ' $ 3 1 4 ; , P A S T E C L I P () ; ,

    - ; Windows

    574 III.

  • , MOVE COPY. - , BLOCK. , .

    , , - Cut to Clipboard ()

    , Copy to Clipboard(). , - Paste from Clipboard () . - AutoCAD , .

    "& 27, " ", ,

    Windows -

    . AutoCAD , - INSERT (). , - My Computer ( ) Windows Explorer() ( Windows Explorer). .

    1. Windows Explorer (StartoPrograms^Windows Explorer(^ )).

    2. .

    AutoCAD , .

    AutoCAD , AutoCAD ; , AutoCAD, - ,

    3. , .

    . 18.15 ab-window. dwg WindowsExplorer AutoCAD.

    , , AutoCAD, .

    , ( ) Windows Explorer.

    . , , Windows Explorer -, Select Drawing File ( ).

    , , , Windows.

    ^ Start&Find*>Files or Folders (^^ ), -&\ Find () . ,

    , , c*.dwg e Named (). - , .

    18. 575

  • abio-kdov ... D

    JjjE^owg-Au [|BAutoCAD 200... jfjJAuioCAD20D .

    . 18.15. :

    . , - . Window^Tile Vertically(^ ). ( ), . , . - .

    b: a b l 8 - f - l . d w g a b l 8 - f - 2 . d w g , D r a w i n g s -.

    . Windows

    1. a b l 8 - f - l .dwg -1 -. (. 18.16).

    ||3^. 2. ( ) -1^3 Copy to Clipboard ()

    .

    3. Open () - . a b l 8 - f - 2 . d w g -. - (. 18.17).

    . 18.16.

    576 ///.

  • 4. a b l 8 - 6 . d w g AutoCAD B i b l e - .

    5. Paste from Clipboard () -. Specify i n s e r t i o n p o i n t : ( :) 1 (. . 18.17). , - X Y . ( LOBBY) .

    6. WindowTile Vertically ( "^ -). . ab-f-1. dwg . . , . - 8- . dwg .

    7. Close a b - f - 1 . dwg. 8 - 6 .dwg .

    8. Start^Programs^Windows Explorer (1^1^). a b l 8 - f - l . dwg -. - Windows Explorer, - AutoCAD.

    9. a b l 8 - f - l .dwg Windows Explorer AutoCAD .

    10. Specify i n s e r t i o n p o i n t : ( :) - 2. ZOOMWindow ( ).

    . , -. .

    12. . , . 18.18.

    , . .

    . . -

    , , -, .. . , . .

    , AutoCAD - . 20, " ".

    , . - ( , - , , , , ..). , , .

    18. 577

  • O Q

    . 18.17. , 18.18. - -

    . . , , . -, , , .

    , . (tag), . AutoCAD . , - COST (), 8 6 5 . 7 9 .

    , , ,

    . , - . -, .

    , , .

    Draw^Block^Define Attributes(^^ ). ATTDEF (), Attribute Definition ( ), - . 18.19.

    578 III.

  • H Attribute Definition

    . 18.19. Attribute Definition

    Mode Mode () , -

    . !8.3.

    18.3.

    Invisible () , , . , , ., , ,

    Constant , AutoCAD -() ( Attribute () )

    . , , , . -

    Verify . ,()

    Preset . , () A m e r i c a n

    i n t e r i o r s , . , , -

    , . - . , ATTDIA 1. , - AutoLISP, - . Verify() P r e s e t () .

    18. 579

  • Attribute Attribute () Tag () , -

    . . - . , , . .

    Prompt () . - . PUR_DATA (), - Date Purchased ( ).

    Value () , -, .

    , - . ,

    ^ dd/mm/yy , , ^S .

    Text Options Text Options ( ) -

    . Justification () Text style (). ( Rotation ()).

    Insertion Point Pick Point ( ), . -

    , , . -, . , , . - , , ATTDEF (). 0,0. , .

    , 0,0 . ,

    ! . , , 0,0. 0,0 , , . Undo () - .

    Align below previous attribute ( ) . , - .

    , , -. .

    Properties () - -, , .

    Modify1^Text (^ ) , ( DDEDIT ()).

    580 III.

  • , , , -

    . -'| .

    , .

    Make Block Draw. .

    , , -

    . - , . , -, .

    . RetainObjects ( ), .

    , . , .

    ^100** . Tia , , . -

    , . BASE () ( 0,0) . . , AutoCAD , - . , , .

    Properties(). .

    abl8-g.dwg, - Drawings -.

    . 1. abl8-g.dwg -. -

    , . (. 18.20).

    2. 8 - 7 . dwg AutoCAD B i b l e - .

    3. Explode Modify . . .

    4. Draw^ Blocks Define Attributes (^ ^). Attribute definition ( ) Invisible () Mode ().

    18. 581

  • 5. Attribute () mfr, Manufacturer, American Office Furniture.

    6. Pick Point, - . 1, . 18.20. Text Options ( ), . , - .

    7. ATTDEF (). Align below previous attribute ( - ). pur_date, Date purchased, 3/19.

    8. .

    9. Make Block - Draw. Name armchair. Select Objects ( -). -. . - , 18 . Pick Point. - , 2 - . Delete Objects ( ), - .

    10. AutoCAD, , Yes (). , .

    11. . , .

    . 18.20.

    , . , , . - . - - .

    , . -

    AutoCAD , .

    _^*"** , , , A T T D I A 1.

    abis-7.dwg, - Results -.

    582 III.

  • . 1. 8 - 7 . dwg, -

    . R e s u l t s -,

    2. 8 - 8 .dwg AutoCAD B i b l e . ATTDIA 1.

    3. Insert Block () Draw (). ARMCHAIR Name, Specify On-Screenis checked ( ) Insertion Point () .

    4. ( OSNAP -, , .. Endpoint). , X Y . Enter Attributes ( ), . 18.21. - , ; .

    ErKerAltiiliutes

    /S)

    111

    \ .

    , ,

    ?'

    i_

    - >

    ft*. * " -

    >? ".'-;V'i

    . 18.21. Enter Attributes

    5. , , , . -, , . 3/92. , ( - ), .

    6. ,

    , ,

    Properties () DDEDIT () ( - Modify^Object^Text (1^^)).

    , Block Attribute Manager( ),

    18. \ 583

  • Block Attribute Manager AutoCAD 2002. Edit Attribute () Block Attribute Manager -

    ! .

    , -

    :

    ;

    ;

    ;

    ;

    (, , , ).

    , .

    , BATTMAN, Block At-tribute Manager (. 18.22), ModifyOObject^Attribute^Block AttributeManager (^1^ ). (, - Block Attribute Manager, Modify II.)

    . 18.22. Block Attribute Manager

    Block () Block Attribute Manager , . SelectBlock ( ) . Block At-tribute Manager .

    -. Block Attribute Manager - Move Down ( ), Move Up( ). , - , .

    . , Delete ().

    , Block AttributeManager. Settings (). Settings , -

    584 III.

  • . , , ( ) . .

    Block Attribute Manager - , .

    , , -, . Edit (-), Edit Attribute, . 18.23.

    FiiH AttributeBbc*, ARMCHAIR

    - *

    .-***

    ! -1.

    9 M

    1 I";* " I'achuei

    " - . JC.'^iK.!..

    uto tttmn -J.s^si

    . 18.23. Edit Attribute

    -. Sync (). - Edit Attribute. , - , -, .

    Edit Attribute, , .

    Attribute (). ., Mode () , Data () , .

    Text Options ( ). , ,, .

    Properties (). , , .

    , Edit Attribute, Block Attribute Manager, , .

    , , . - ATTDISP. , View1^Display^AttributeVisibility {^^ ), -. .

    Normal (). , , , , , . .

    18. 585

  • On (). .

    Off (). .

    , AutoCAD .

    - . ,

    , , , -- . Modify^ObjectoAttribute^Single(1^ 1^ 1^ ) ,* . ( EATTEDIT Edit Attribute ( ) Modify II.) Enhanced Attribute Editor, . 18.24.

    |[* .FrilMNi.t'iI AHrilitttf- Fiiilm

    PUR.DATE DaM purchated /

    Puc. 18.24. Enhanced Attribute Editor

    , Edit Attribute. Attribute () , Edit Attribute, , , - Value ().

    Text Options ( ) Properties () Edit Attribute.

    !

    , , - .

    - ATTEDIT ( ). Edit Attributes ( ), . 18.25.

    , . .

    , , -atteclit. E d i t a t t r i b u t e s one at t ime? [Yes/No] :( ? [/]) Yes. , , , ..

    586 III.

  • MEdilAthileiocfcnamr '.ARMCHAIR

    ^ 1

    . 18.25. Edit Attributes

    ATTEDIT .

    , E d i t a t t r i b u t e s oneat t ime ( ). , , , , , . E d i t a t t r i b u t e s one at t ime No () - , - -.

    ATTEDIT , .

    1. Modify=>Object=>Attribijtei=>Global (^ '* ).

    2. E d i t a t t r i b u t e s one at t ime? [Yes/No] : (- ? [/] :)

  • 7. S e l e c t a t t r i b u t e s : ( ), , . , w
  • , 18.26.

    3. Modify^Object1^ Attributed Single (1^ 1^1^ ) ATTEDIT. Se lectb lock: ( :) , 1 (. . 18.26). Edit Attributes ( ) - 4/97 . , American Office F u r n i t u r e . , - .

    4. , View^Display^Attribute Display^On. , - . , , Normal ().

    5. Modify^ Objects Attributed Global (1^ 1^1^) ATTEDIT. :

    Edit attributes one at time? [Yes/No] : n

  • . , - Specify insertion base point of new Block: 2

    8. .

    9. Insert Block. Insert Name - armchair. Specify On-Screen Insertion Point - . , 2, . Enter Attributes () .

    10. , , Modify^Object^Attribute^Single. , 3. , Color () Dusty Blue (-). , .

    . Zoom Window ( ), - 4 (. . 18.26). . , , .

    12. Modify^Object^Attribute^Global. Block Phone Edit.

    13. Attribute Edit Attribute Extens ion. Text Options Justification Fit. Properties Color Blue, , Cyan, . , .

    14. ,

    15. Zoom Previous ( ) -. .

    , ,

    , . 18.27.

    AutoCAD. : .

    !

    Select Drawing ( ) , - . , Current Drawing ( ). , , () , . - , Next ().

    Settings () .

    Include xfers ( ). ( - 19, " ") . , -, .

    590 ///.

  • . 18,27.

    Include nested blocks ( ). - , , .

    Next UseTemplate ( ). NoTemplate ( ), Use Template ( ). , Use Template( ) . . , Next.

    AutoCAD 2002 , , - .

    .. " . , , ! .

    Select Attributes ( ), . 18.28, , , . - , , . .

    , . Check All( ) Uncheck All ( ) , . , -, . , Next.

    View Output ( ) .

    , , .

    , .

    , Alternate view( ). Copy to Clipboard ( ), - . - , . - Next.

    18. 591

  • . 18.28. Select Attribute

    AutoCAD SaveTemplate ( ). -, . , Next. Save Template ( ), Save As (). . .blk. Save (), Next .

    , , , AutoCAD ( .dwt). , ASCII. - .blk-, .

    Export () , . , .

    File Type ( ), .

    CSV (Comma delimited)(*.csv). - . - .

    Tab Delimited File (*.txt). CSV, , .

    Microsoft Excel (*.xsl). Excel.

    Microsoft Access Database (*.mdb). Access,

    , Finish (). , , - . Yes(). .

    592 III.

  • , , -, , "". , ATTEDIT ().

    , Windows. . , - . AutoCAD , , , . :Twwwppp

    ( N );www ( ), ; . 000.

    , $999.99 N006002. , ; 00 6 , , ; 002 .

    , , AutoCAD - . . . BL:, . .

    B L : L E V E L NwwwO 0 0

    BL:NAME Cwww 000

    BL: Nwwwppp X

    BL : Y Nwwwppp Y

    BL: z Nwwwppp Z

    B L : N U M B E R NwwwOOO

    BL:HANDLE CwwwOOO

    BL : LAYER CwwwO 0 0

    B L : O R I E N T Nwwwddd

    BL:XSCALE Nwwwddd X

    B L : Y S C A L E Nwwwddd Y

    B L : Z S C A L E Nwwwddd Z

    BL:XEXTUDE Nwwwddd -

    BL : YEXTUDE Nwwwddd Y-

    BL : ZEXTUDE Nwwwddd Z-

    , . - (handle) - , . , List () - Inquire () . - . AutoLISP - . , , - . ( "" 24," ".)

    18. 593

  • .

    , , .

    * , .

    ! ( ; .)

    , , .

    * - .

    . , - , -. , - . , - . , , :DUMMVl C002000

    , , - , DUMMY2. . . - , , , - .

    , , . t x t . , A T T E D I T ,

    Attribute Extraction ( ) Template File ( ) . ,1 , . , AutoCAD .

    Bl:NflMEBl-.SiDUMMV1BL:VDUMMV2DIUISIOHMFRPUR DfiTECOSTCOLOR

    CBB1BOONBB7BB2NBB7BB2CBB2BBB 015000 026006 008 008N007002015000

    a b l 8 - i .dwg, - Drawings -.

    . 1. a b l 8 - i .dwg -. -

    , (. 18.29).

    2. Tools Attribute Extraction (=> ), .

    3. Drawings - Current Drawing. Next.

    4. Settings . Next, .

    594 ///.

  • . 18.29. -

    5. Use Template No Template, Next.

    6. Select Attributes Uncheck All, , Armchair. - Uncheck All, Attributes for Block^ARMCHAIR^ :

    X insertion point ( X );

    Y insertion point ( Y );

    Orient ();

    COLOR ();

    PUR_DATE ( );

    MFR.

    7. Next.

    8. , - . , , - Alternate View. Next,

    9. Save Template Save Template. - 8 - 2 . AutoCAD Bible.( . b l k , AutoCAD .) Next.

    10. Export File Type CSV(Comma delimited)(*.CSv). ( Microsoft Excel Microsoft Access, , - .)

    . , File Name ( ), AutoCAD Bible . - 8-2 Save.

    12. Finish.

    18. S95

  • 13. , , Note-pad. File^Open (1^ ), AutoCADB i b l e 8 - 2 . csv, ( Filesof Type ( ), , All Files ( ).) - Open , . 18.30.

    Block Name.Count, insertion point,V insertion point,Orient,COLOR,PUR DftTE.MFRARMCHAIR.1.291.33694B,491-369637,0.000000,Dusty Blue,3/91,Acne Office FurnitureARMCHAIR.1.36.296775,397.790128,0.000000,Dusty Blue,3/91.American Office FurnitureARMCHAIR,1,62.913516,475.571*03.0.000000,Dusty Blue,3/91.American Office FurnitureARMCHRIR.1.31.302370,475.34919*,0.OOOOBO,Dusty Rose,3/91.American Office FurnitureARMCHAIR,1,26.761999,500.838*70.11.712389,Dusty Blue,3/91 .American Office FurnitureARMCHAIR,1,30.394294,522.24S688,3.1*1593,Dusty Rose,3/91.American Office FurnitureflRMCHflIR,1,63.B8494S,523.152811,3.1*1593,dusty Blue,3/91.American Office FurniturefifWCHfllR,1,136.147294,830.104117,3.665191,Dusty Blue,3/91.American Office Furniture

    Puc. 18.30. , -

    14. , .

    15. .

    , - Multiline Text Editor,

    . , - .

    , . -, . , , , .

    .

    . .

    , . - .

    Windows. . - " " .

    , . . , - . . AutoCAD . , - , .

    . , . . - -, , .

    596 III.

  • , - AutoCAD . -

    , - ., AutoCAD - , () , .

    (external reference, xrej), - , -, . . - , . , . , .

    .

    - - . , , . - ( - ) .

    . . , - , , .

    "B '..3!"-;.

    . - J-

    . >"..

    .

    1

    \:> ,"*1" 1:- ' '*I

    -

  • , .

    , (.. - ), . , . .

    , -

    . Reference (). , , Reference () .

    , .

    External Reference ( ) Refer-Lfc--J ence (). Xref Manager ( ), - . 19.1. .

    -"IXiel

    . 19.1. Xref Manager

    1. , Xref Manager - (. . 19.1). - . , Attach() Select Reference File ( -), Open (). External Reference ( ), . 19.2. ( ).

    2. Reference Type ( ).

    Attachment (): , , , . , .

    Overlay (); . , .. .

    598 III.

  • Mltxlernal Reference

    Reference Typttf Attachment >*.?-? I-

    j-lnseftcn per*,J~ SpsciyOrwwieen "

    . 19.2. External Reference

    , . .

    3. , - X Y, , - . , , .

    4. Retain Path ( ), , . , Support F i l e s ( -) P r o j e c t F i l e s ( ). Files () Options ().

    5. , , .

    , - , ZOOM E x t e n t s ( ).

    AutoCAD,

    . (Wing T. Duong) Pacific Engineering Associates, (. ). - . , - , . -, . , -

    19. 599

  • , ; -. . , , ; -, ; -, , , , , , .

    , , , , , .. . --, - . . " ", - . - , , . , . - , .

    , , . - , . .

    600 III.

  • , ,

    External Reference Reference. - Xref Manager. .

    ti=*$j ( List View). 1! , , , , ( ).

    ( Tree View). - . .

    . , , .

    - , Xref Found At ( ) .

    . , , - . , - . - , -. - .

    abl9-a.dwg abl9-a.dwg, Drawings --.

    19. 601

  • . 1. abl 9-a. dwg -.

    2. Windows Explorer () 9 -b . dwg - AutoCAD Bib le .

    3. External Reference Attach ( ). Select Reference File ( ) abl 9-b . dwg. Open ().

    4. External Reference ( ) . Specify On-screen ( ) . -a.dwg a b l 9 - b .dwg.

    5. a b l 9 - l .dwg AutoCAD Bible .

    6. , acad.dwt. FormatoDrawing Units (^), Architec-tural (), Drawing units for DesignCenter blocks ( DesignCenter) Inches. - . 9 - 2 .dwg AutoCAD 3 i b l e .

    7. External Reference Attach ( ) - Reference. Select Reference File ( ) abl 9 - 1 . dwg, AutoCAD Bible . Open ().

    8. External Reference ( ) -. . - 9-1 .dwg, , . (ab l9-b .dwg)~ , ( 9-1. dwg). :Attach Xref AB19-1: C:\AutoCAD Bible\abl9-1.dwgAB19-1 l o a d l e d .Attach Xref AB19-B: E:\AutoCAD Bible\abl9-b.dwgAB19-B loaded.

    :--j 9. , _bd External Reference ( ) Reference.

    Xref Manager , . Tree view ( ) - . -, (. 19,3). Cancel.

    10. . , . 19.4.

    . AutoCAD 2002 - . , - , , . (Jn-place editing).

    .

    1. .

    602 III.

  • . 193,

    . 19.4. , - .

    2. , .

    3. , , , .

    4. , AutoCAD.

    5. , -, .

    6. .

    , - . AutoCAD Reference Edit( ), . 19.5,

    19. 603

  • . 19.5. Reference Edit

    ^ ** , AutoCAD 2000i. -

    ^=~ , : Modify^In-place Xref and! Block Edit&Edit Reference (^

    ), , .

    , - - , . Next ().

    .

    Enable Unique Layer And Symbol Names ( ) , - $#$. "" - .

    Display Attribute Definitions For Editing ( - ) - . ( 18," ".)

    Reference Edit .

    , Auto-CAD, , AutoCAD 2002.

    . , - , -. ( ) - 50% ( - XFADECTL).

    Refedit ( ), . 19.6, Use REFCLOSE or the Refedit t o o l b a r to end re fe rencee d i t i n g s e s s i o n ( REFCLOSE Refedit). .

    604 ///.

  • . 19.6. Refedit

    , -

    , .

    , .

    . .

    . - , , . , , - , .

    . - Refedit Add Objects To The RefeditWorking Set ( Refedit). He , . , - , .

    . - Refedit Remove Objects from TheRefedit Working Set ( Refedit). He , . , , , .

    , Refedit Save Back Changes to Reference ( ). , Discard Changes to Reference ( ).

    , , - , . () -, , , AutoCAD , .

    ' IT*;- a b l 9 - a . d w g- a b l 9 - a . d w g , D r a w i n g s -

    j"~'" -.

    19. 605

  • . 1. -a.dwg -.

    9 - 3 . dwg AutoCAD Bible .

    2. -b.dwg -. 9-4. dwg AutoCAD Bib le . , - AutoCAD. 9-3.dwg - , .

    3. Insert^External Reference (^ ) AutoCAD Bible abl9-4 .dwg. Open. External Reference Specify On-screen . AutoCAD 9-3. dwg , 9-4 .dwg.

    4. . Reference Edit, - 9-4 . .

    5. S e l e c t n e s t e d o b j e c t s : ( -:) , . - AutoCAD . AutoCAD Refedit ( ). . AutoCAD , . 19.7.

    . 19.7, -

    6. Explode.

    7. DrawoTextoSingle Line Text (^ ^). Specify s t a r t p o i n t of t e x t or[ J u s t i f y / S t y l e ] : ( [/]:)

    1 (. . 19.7). Specify h e i g h t

  • 9. ( ) - , .

    10. N 2 . 19.7. . Refedit Remove Objects from The Refedit Working Set ( - Refedit).

    11. Save Back Changes to Reference ( - ) - . , 0 , . :The following symbols w i l l be permanently bound to the c u r r e n tdrawing:Layers: $O$TITLEBLKText S t y l e s : $O$STANDARD, SOSROMANS, $0SROMANDBlocks: S0$KNTITLRegenerating model.11 o b j e c t s added to ablS-41 object removed from abl9-41 xref i n s t a n c e updated9-4 redefined and re loaded.

    12. External Reference Reference. Xref Manager ( ) abl9-4 .dwg Detach (). ( .) . , 9-3.dwg North () N , "" . .

    13. , abl9-4.dwg. North N "", ,

    14. , 9-3 . dwg .

    ,

    . AutoCAD - , - .

    (dependent symbols) : ,

    , .. , - . , Layer Control( ) . - : xref_name I symbol_name (__]_). - -.

    19. 607

  • , .

    Layer Properties Manager( ). . , . - , VISRETAIN 1.

    , 0, 0. 0 - , ByLayer, - . ByBlock, - , . , .

    XBIND AutoCAD, , -

    , .. , , XBIND (). - . , . - xbind

  • Warning: Circular reference from XREF to current drawing.( AutoCAD )Circular reference(s) have been found. Continue? Y Breaking circular reference from XREF to current drawing.

    .

    . - XCLIP ().

    , Modify^Clip^Xref ( ) External Ref-erence Clip ( ) Reference (). - AutoCAD . -, , , - .

    . 19.1 XCLIP.

    \ 19.1.

    On () , - . . - ,

    o f f () . - . . , , - . on ,

    c i i p d e p t h . ( , .) AutoCAD -

    , . - Remove (}

    D e l e t e ()

    G e n e r a t e P o l y l i n e , . , -( P E D I T () -)

    New b o u n d a r y . , -( )

    s e l e c t -p o l y l i n e . ( )

    19. 609

  • . 19.1

    Polygonal()

    Rectangular()

    , , , - , . , . ,

    , ,

    .

    ( , ), - XCLIPFRAME 1.

    . 19.9 . XCLIPFRAME , . . 19.4, .

    . 19.9. -

    , - , , , (GIS). , . : .

    . - AutoCAD, -

    610 III.

  • , . - , .

    . AutoCAD, , - . , - .

    , - .

    .

    .

    ( ), , / ( ).

    , 8, " ".

    , Too Is Options ( )

    Options, Open and Save( ). Demand Load Xrefs ( - ) Enabled (). , , - - . - , Enable with copy ( ), - , . . . .

    , , -

    . . , - . , - File^Save As (^) Save DrawingAs ( ), Options () Saveas Options ( ), (. 19.10) DWG Options ( DWG). . 19.10. Saveas Options

    19. 611

  • Index type ( ) Layer & Spatial( ) Spatial (). . Saveas Options .

    , - Export Options ( )

    ., Cancel (), .. -" . INDEXCTL.

    :

    Updating Indexes for block *MODEL_SPACE

    , File^Save As ( ), Options () . - Saveas Options ( ) None () - Index type ( ). , Saveas Options Cancel.

    , , . -

    . - , - . -, File^Save As Save Drawing As. Options Saveas Options (. . 19.10).

    Index type Layer & Spatial Spatial. . Saveas Options .

    :

    Updating Indexes for block *MODEL_SPACE

    , File^Save As, Options. Export Options None Index type. , Export Options Cancel.

    abi9-a.dwg,abl9-a.dwg, 9-1 . dwg 9-2 . dwg, Drawings -.

    . 1. 9 - 1 .dwg AutoCAD Bible,

    .

    2. ! , Windows Explorer () -a.dwg abl9-b.dwg -, ab l9- l .dwg abl9~2.dwg R e s u l t s -. AutoCAD Bible . ab l9- l .dwg , ( abl 9-a. dwg abl 9-b . dwg),

    612 III.

  • Tools^>Options, Project Files Search Path ( ) Files (). Add () Au-toCAD Bible . Browse () .

    3. File^Save As ( ). Op-tions (). Saves Options ( ) - Layer & Spatial (, ). - , Cancel.

    4. Save (). - .

    5. 9-2 .dwg AutoCAD Bible. - (. 19.11).

    . 19. .

    6. 9 - 5 .dwg AutoCAD Bible .

    7. Tools^Options (6* ) Options, Open and Save ( ). De-mand Load Xrefs ( ) En-abled (). (, .) .

    8. Layer Control ( ). On/Off (/) 9-11 notes, - . . notes .

    9. External Reference Clip ( ) Reference () Modify^Clip^Xref(^ ). XCLIP. :

    Select objects : - (. . 19.11)Select objects:

  • Specify clipping boundary:[Select polyline/Polygonal/Rectangular] : Polygonal () - Specify f i r s t p o i n t : 1 (. . 19.11)Specify next point orSpecify next point orSpecify next point orSpecify next point orSpecify next point orSpecify next point orSpecify next point orSpecify next point orSpecify next point orSpecify next point or

    10. .

    11. 9-11 n o t e s .

    12. . , . 19.12. , .

    [Undo]Undo]

    Undo]

    Undo]

    Undo]

    [Undo]

    [Undo]

    [Undo]

    ;Undo]Undo]

  • 19.2. External Reference ( )

    1

    Attach External Reference ( ), , () ,

    Detach . , -()

    Reload . () .

    , ( - - ) . -

    Unload . , () . ,

    Reload ()

    Bind . Bind Xrefs() ( ),

    Bind () , , .. (,

    ) x r e f _ n a m e I symbol__name drawing__name$#$symbol_name, # -, , 1 . , . , , -

    Insert -() x r e f _ n a m e |. -

    , - . , .. -

    Xref Found At , ; -( . ) , Save Path

    ( ). S u p p o r t F i l e s ( ) p r o j e c t F i l e s ( ), Not Found {He ). Browse (), , Save Path ( ). , -

    .

    1

    19. 615

  • A u t o C A D D e s i g n C e n t e r

    IDesiqnCenter ,

    , , - Auto-CAD DesignCenter. , AutoCADDesignCenter . , . Xrefs ( ) , - . , Preview( ). DesignCenter (. 19.13).

    , . External Refer-ence ( ) (. . 19.2), .

    . 19.13. DesignCenter :

    XREFCTL 1 ( 0),

    , , ASCII-. . . 19.14 . , , . , , . xlg.

    , . 19.14, . , ! -, , , . ( ) .

    9-5 .dwg, - Results -.

    . 1. 9 - 5 .dwg AutoCAD Bible,

    . , R e s u l t s -.

    2. 9-6 .dwg AutoCAD Bib le .

    3. Modify^Clip^Xref. S e l e c to b j e c t s : . E n t e r c l i p p i n g

    616 III.

  • option [ON/OFF/Clipdepth/Delete/generate Polyline/New boundary]: ( [// // / ]:) Delete () - . - , -. External Refer-ence ( ) Reference (). TreeView ( ). 9-. Unload() . 9- .

    4. XREF. - 9-. Reload (). .

    XREF. 5.

    Drawing: E:\ftutoCAD Biole\atH9-2.dtqDate/Tine: /25/01 09:31:it*Operat ion: Reload Xref

    Reference tree for "AB19-1":"19-"-AB19-B"

    Reference tree for "AB19-B11:

    "AB19-B"

    Reload Xref "AB19-1": 3&19-I.dwg

    Searching in acad search path

    Update block synbol table:Appending synbol: "19-1|D0CR"Appending synbol: "19-1JKHTITL"Appending synbol: "AB19-1|IUB"Appending symbol: "19-1|TQILET"Appending synbol: "nB19-1|LAU"Appending synbol:

    AB19-1|ELLIPSEP1

    . 19.14. -

    9-1. Bind (). BindXref ( ) Insert () . External Reference. ( - 1 9 - ) . ( Layer Control ( ) , , .)

    .

    .

    , . . AutoCAD - , , , , - Xref Manager.

    AutoCAD SQL.

    19. 617

  • . _ - .*. rj J

    _ . . . _

    J -

    utoCAD -

    . - . , . - . , -, , .

    AutoCAD - , , - , , , - , . , , - AutoCAD : . , . , , - , .

    AutoCAD - (external databaseaccess). .

    AutoCAD .

    .

    ,

    .

  • :

    Microsoft Access 2000, 97 95;

    Visual dBASE 7.01;

    dBASE V III;

    Microsoft Excel 2000, 97 95;

    Oracle 8.0 and 7,3;

    Paradox 8.0 and 7.0;

    Microsoft Visual FoxPro 6.0 5.0;

    SQL Server 7.0 6.5.

    , , , , , .

    , (, DBMS). , . -, , . , , .

    . 20.1 , - .

    20.1.

    /

    8665-023-012 - .030 Stainless

    8665-023-013 - .045 Dia Stainless Steel

    8665-023-014 - ,045 Dia S.S.

    , , - .

    SQL (Structured Query Language ) - . AutoCAD SQL2, (environment), (catalog) (schema). SQL2 , , .

    , , - , , - .

    , , .

    , .

    , . , AutoCAD - , , .

    20. 619

    FTFTFT

  • .

    1. , AutoCAD .

    2. , ODBC Data Source.

    3. , - .

    4. MicrosoftODBC OLE DB.

    5. AutoCAD.

    6. dbCONNECT.

    7. , .

    8. .

    9. Data View ( ), .

    10. .

    11. .

    12. .

    AutoCAD.

    (Full), (Custom) AutoCAD. Database Custom Components ( ).

    , , - Tools (). dbConnect ( ) , AutoCAD .

    , - .

    1. - , -, StartoRun d:\Setup.exe, d -. .

    2. Next ().

    3. Add (),

    4. Database Next.

    5. , - .

    620 III.

  • , ,

    , . - Microsoft Access.

    -. , -, (- ).

    ab20-prt.dwg, - Drawings -.

    . 1. Start () -

    Explorer ().

    2. AutoCAD Bib le Windows Explorer, "+" , .

    3. AutoCAD Bib le File^NewOFoider(1^ 1^ ). ; - Databases .

    4. "+", AutoCAD Bible . D a t a b a s e s ( , ).

    5. a b 2 0 - p r t .mdb - Databases, . - ab20-prt .mdb, a b 2 0 - p r t . x l s . . 20.1 , , Microsoft Access.

    6. -, , . Properties (). Read-only ( ) .

    7. Windows Explorer.

    -

    AutoCAD ( data source) - ODBC OLE DB. AutoCAD \ Sample MicrosoftAccess db_samples .mdb, .

    ODBC (ODBC DataSource Administrator). , , , - Control Panel { Start^Settings^Control Panel(^ )). - ODBC Data Sources (32 bit) , , - .

    20. 621

  • *.Mi..iuM.llA
  • Stium-Ailmuii'.

    Microton H C C M t UlWer I H1DDJ

    M e r o t o U d S m Dnvtr I'.dbf)

    M i e r c w l t d B a t a V F P Drive

    Miwoioft Exct l Driver ['.Mltl

    Miciotofl F O I P I O Driver ( " . * ( )

    Microtoft F O K P I O V T P Oiivr

    M c i o t o f l A c c e i t D i i v e i

    MlerowJl * Drivw (" mdb)MicrotoK Accm Driver j'.mdbj

    Flnvw I* mrihl

    AdvWwkdBASE FriMdBateFieeWordE-cdFletFoxProFoxPro Fiet-WoidMS Accett 37 DataosuMS Acciti DtibMt

    Puc 20.2. ODBC Data Source Ad-ministrator, -

    4. Create New Data Source ( ) - , , Finish ().

    5. ODBC Setup ( ODBC), - , Data Source Name( ). . -, , .

    6. Select () , ; - .

    7. .

    8. ODBC Administrator ( ODBC) . - , .

    AutoCAD.

    1. Tools^dbConnect (^ ) - dbConnect ( ) .

    2. dbConnect^Data Sources^Configure ( 1^). Configure a DataSource ( ) , . .

    3. Provider Data Link Properties ( -) Microsoft OLE DB Provider for ODBC drivers Next.

    4. Connection () , - ODBC Setup, . 20.3.

    5. .

    6. Test Connection ( ). . -

    20. 623

  • , , . .

    7. Data Link ( ).

    * U

  • 6. ODBC Data Source Administrator.

    7. AutoCAD, ab20-a .dwg -. ab2 0-l .dwg AutoCAD Bible.

    8. Tools^dbConnect ( ) dbConnect . dbCon-nect^Data Sources^Configure. Configure a Data Source( ) a b 2 0 - p r t .

    9. Provider () Data Link Properties ( ), , Microsoft OLE DBProvider for ODBC Drivers Next.

    10. ab20-Access.

    11. Test Connection ( ). . Next.

    12. Data Link Properties ( ).

    13. ab2 0-l .dwg .

    Excel

    Excel, - .

    1. . , . 5 MDB- ab20-prt. x ls.

    2. ODBC - ODBC Data Source Administrator.

    3. User DSN ODBC Data Source Administrator Add.

    4. Create New Data Source Microsoft Excel Finish.

    5. ODBC Microsoft Excel Setup - ab Excel. , .

    6. Select Workbook AutoCAD B i b l e \ d a t a b a s e s \ab20-prt. x ls. , , , .

    7. AutoCAD, ab20-a.dwg - - ab2 0- l .dwg AutoCAD Bible. Tools dbConnect.

    8. dbConnect^Data Sources Configure Configure a Data Source ab Excel, .

    9. Provider Data Link Properties Microsoft OLE DBProvider for ODBC dn'vers Next.

    10. ab Excel.11. Test Connection. -

    .12. Data Link Properties.

    , . Excel . , , .

    20. 625

  • . , .

    .

    .

    () .

    .

    ( ) .

    , - .

    Q jo(_dbtempletQ ab20-prl

    . 20.4. dbConnect Manager

    - dbConnect Manager( ), . 20.4. dbConnect Manager , .

    dbConnect Manager - - . . dbConnect Manager .

    dbConnect Manager .

    .

    1. , .

    2. Tools dbConnect (^ ) dbConnect Manager.

    3. , - ( AutoCAD ) Connect.

    AutoCAD , . - , - AutoCAD. , .

    626 ///.

  • . 1. ab20-l .dwg

    .

    2. Tools=>dbConnect dbConnectManager.

    3. a b 2 0 - p r t Connect. dbConnect Manager PART NO.

    4. .

    , .

    "+'' , . "+", , ( ).

    Data View.

    , . - View Table.

    AutoCAD, Edit Table,

    View Table( ) Edit Table ( ), - dbConnect.

    . 20.5 Data View ( ) Edit Table ( View Table , - , ).

    Data View ( ) , . .

    . . - .

    Resize a column ( ). , . ; - , .

    Move a column ( ). , . , , . .

    Hide a column ( ). , . , , -, , - Hide. Unhide All.

    20. 627

  • -

    Dili View "PART NO" ( CtvAutoLAD Bilili:1 ali?fl t.dwii)

    8665-023^)1265-013B665-023-0148685-023 0150665-023-01665-23-786654)73-0428685-079 0008685-032-00085-09740286B54)97-00386B5497-004B685-117-001BG85-118-00186B5-11-0018688-003000697-0408711-001 -001B711-OO2-0D16711-002 0028711-003-00187114103-0028711-003 136711004-0010711-005-001

    J j j Record 1

    WELDING WIRE - .030 STAlHLE WELD RDD - .045 D1A STAINLES WELDING - ROD .045 DIA S.S. WELDING ROD-1/16DIA TYPE WELDING ROD WELD HDD - 052 MS ( COIL] NIPPLE U X 2 1/2 |NQT GALV TAPE ATAPE TEFLON ATAPE TAPE TAPE -STRAPPING TAPETAPE-DUCT ATAPE - FOAM. DBL SIDE ADHES PIN - DOWELL AGAUGE -PRESSUHE ATRANSFORMER TRANSFORMER - CONTROL TRANSFORMER -CONTROL TRANSFORMER TRANSFORMER TRANSFORMER TRANSFORMER TRANSFORMER -DRY

    FTFTFTFTFTFTEACHININININININFTINEACHEACHEACHEACHEACHEACHEACHEACHEACHEACH

    . 20.5. Data View

    Sort records ( ). . . - Sort , . 20.6. SortBy Ascending Descending. , - Then By, . , - .

    Freeze one or more columns( -). "" , -, - . - . - , , - , . -

    . 20.6. Sort - Data View

    628 III.

  • Freeze. , , Unfreeze All,

    Align text ( ). . - , . - (), Align. :Standard, Left, Center Right.

    Format text ( ). , , , , , Data View. , - , Data View. Format Data View^Format, .

    Data View ;- -

    - Allow Docking. (, , dbConnect ).

    , - . - , .

    1. , , . , .

    2. Data View^Find ( ^) Find (), . 20.7 ( Find).

    . 20.7, Find

    3. Find (, -), (Up Down). , - Match case, . Find Next , - . .

    , , - . (); - . - . , , Paste .

    .

    20. 629

  • C:\AutoCAD Biblo\ab2Q-1.dwflY? DataSouicoi

    ( ^ jet_dbtsniplet;-: f=) ab2Q-pH

    . Data View1. 20-1 .dwg .

    a b 2 0 - p r t "+", PARTNO. dbConnect , . 20.8.

    2. Edit Table. Data View (); , - .

    3. AutoCAD Data View=>Format( 1^ ) - Format Arial 10. .

    4. , - , .

    5. PART_NO Align^Right . Data View , . 20.9.

    . 20.8. - dbConnect

    Data View PART NO" I C:\AmoCAD (til>lt>\dli?U l.dwq I

    i Label Template - _*J 'i l l UTS f

    WELDING WIRE .030 STAINL WELD ROD - .045 0IA STAINLE WELDING -ROD .045 DIAS.S. WELDING ROD -1/16 DIATYPE WELDING ROD

    WELD ROD J952 US (6tW COI NIPPLE -1.2 X 2 (NOT GAL TAPE A

    TAPE - TEFLON ATAPE TAPE

    TAPE - STRAPPING TAPETAPE-DUCT ATAPE - FOAM, DBL. SIDE AON

    PIN-DOWELLGAUGE-PRESSURETRANSFORMERTRANSFORMER - CONTROL

    FTFTFTFTFTFTEACHININININtNFTINEACHEACHEACHEACHcnru

    . 20.9. Data Viewnocsie

    6. . - , - . -; .

    7. DESCRIPTION Sort. Sort

    630 ///.

  • () Sort By ( ) DESCRIPTION Ascending ( ). - DESCRIPTION Then By( ) PART_NO, - Ascending. . AutoCAD -, .

    8. , 9003-242-001. PART_NO Find. Find - 9003-242-001 Direction Down. Find Next. AutoCAD , .

    9. Find . .

    Data View , , -

    , - . .

    () - Add New Record. AutoCAD - ( - ).

    , . Delete - .

    AutoCAD , -- -! , AutoCAD,

    , AutoCAD dbConnect.

    AutoCAD , . Data Table Commit. Restore .

    . 1. Data Table a b 2 0 - l . dwg -

    . , , : 9003-242-001. , . 8 .

    2. MADE/PUR (/) , . , . MADE/PUR 9003-242-001 .

    3. , , - Add New Record. AutoCAD

    20. 631

  • . , -

    :

    8 6 6 5 - 0 2 3 - 0 1 8 WELDING ROD - . 0 5 DIA S . S . FT

    4. He - . - Restore. AutoCAD Data Table.

    5. .

    -

    . , . .

    , , -, , ..

    ( ), .

    , .

    AutoCAD ( )

    . AutoCAD , () - . , - . . - AutoCAD , - ; , , AutoCAD . , , , , .

    {link template) , . . , . dbConnect.

    , .

    .

    1. dbConnecK^Templates^New Link Template( ^^ ) ( , New Link Template ( ) dbConnect).

    2. , AutoCAD Select Data Object ( ), . Continue.

    3. New Link Template Name New Link Template(. 20.10) . AutoCAD -

    632 III.

  • L i n k l , Link2 .. - . -, -, Start With Tem-plate, Continue.

    4. Link Template . - , .

    5. . AutoCAD , dbConnect .

    JjNew l ink Template

    between l

    . 20.10. New LinkTemplate

    . , , -

    (, , , ). , - , . . dbConnect^Templates^Edit Link Template ( ^ ). Select a Database Object - Continue. . dbConnect1^ Templates^Delete Link Template( 1^ ).

    - .

    . 1. a b 2 0 - l . dwg .

    dbConnect PART NO Edit Table Data Table.

    2. dbConnect New Link Template.

    3. New Link Template ( ) -, AutoCAD, PART_NO_Linkl. Continue.

    4. Link Template ( ) PART_NO. .

    5. . , , dbConnect - .

    6. . .

    .

    ,

    ; -, , , ,

    20. 633

  • . , , .. , . , , - , , , . , , .

    .

    1. Data View ( ), , Select a Link Template .

    2. , .

    3. Data View^Link and Label Settings^Create Links( ^ ).

    4. Data View^Link! ( ^!).

    5. AutoCAD . .

    AutoCAD , 1 Record(s) l i n k e dwith 1 Object (s) (I () 1 ()). .

    , - ,

    ! | .

    , - . Link^Delete Link ,

    , .. , -

    . AutoCAD , : , , , , , , . - Data View ( ).

    , , , , Data View=>View Linked Records( ^ ). AutoCAD , . , ( ).

    , , Data View^View Linked Objects ( 1^ ). AutoCAD , , . , .

    Data View , .

    View Linked Objects , -

    , .

    34 III.

  • - , Auto-View, Data View ( ). , .. , - . .

    Data View^Auto-View Linked Objects ( -1^ ), ( ), Data View. AutoCAD . . - Auto-View Linked Objects.

    Data View^Auto-View Linked Records ( -^ ), ( ).AutoCAD . . - Auto-View Linked Records.

    Auto-View, . , AutoCAD 0 Object (s) found matching 0s e l e c t e d Record (s) ( , 0 ). Auto-View .

    , AutoCAD (AutoPan) (AutoZoom) . Data View^Options ( -1* ) Record Indication Settings ( ) - Data View and Query Options ( ) - Show only indicated records, - Show all records. , . AutoPan AutoZoom AutoPan and Zoom . - , - Automatically Pan Drawing Automatically Zoom Drawing. Automatically Zoom Drawing , - 20 90%. .

    , , -

    AutoCAD. , , , .

    : -, , . , - . LinkManager ( ). .

    1. dbConnect^Links^Link Manager (^ ), Link Manager(. 20.11).

    20. 635

  • 2. S e l e c t oneo b j e c t : .

    3. Link Manager , .

    4. Value , - .

    5. .

    AutoCAD . Delete,

    .

    . 20.11. LinkManager -

    AutoCAD (handle) . , AutoCAD ( , List() Inquiry (). , , ( ). , - . , - , .

    .

    1. dbConnect^Links^Export Links (^ ).

    2. S e l e c t o b j e c t s : , . AutoCAD - Export Links (. 20.12).

    Lxtiort Links

    JCMO_!Ch30

    iCh31

    _JL1SP let l t

    j 2 lab example, tut

    I comma-delimited format ["

    Puc. 20A2. Export Links

    3. Include Fields , .

    4. Save In , .

    5. Save as Type : -, - .

    636 ///.

  • .

    AutoCAD -

    6. File name .

    7. Save.

    AutoCAD . - ; , . -- , -. ,, , . Import Text . , . Import Text , . . , ( 27, "' ", - ).

    . 1. ab2 0 - l .dwg -

    . Data View ( ) . PART_NO_Linkl. , . 20.13.

    . 20.13. , . (Robert Mack) Dexter Com-pany, , .

    2. Data View. DataView^Find Find 9 0 0 3 - 2 4 2 - 0 0 1 . -

    20. 637

  • Down. Find Next AutoCAD -. Close.

    3. .

    4. Data View^Link and Label Settings^Create Links( => => ). -, .

    5. Data View^Link! ( ^!).

    6. AutoCAD . , 1 (. . 20.13).

    7. , , 2 . 20.14. - , , . , . - . AutoCAD Data View 1 R e c o r d ( s ) l i n k e d w i t h 8 O b j e c t ( s ) (1 () 8 ()).

    . 20.14.

    8. . , (AutoCAD , ). , , Data View=>View Linked Objects. Data View , . , , - 6, .

    9. . , Data View . - Data ViewoView Linked Records S e l e c to b j e c t s : , ; AutoCAD .

    10. .

    638 ///.

  • (label) , , -

    . , - . .

    , . , . - , - .

    , - . -, .

    , , . -

    , .

    ttw (hit art iMuMfeir fair h * ,otfmw led* - n *e U)4 d hw J

    -it

    11

    1. dbConnect1*Templates^New LabelTemplate ( =>1* ).

    2. Select a Database Object( ) - . Continue.

    3. New Label Template( ), . 20.15, New La-bel Template Name (AutoCAD ). , , - Start with Template. Continue.

    4. AutoCAD Label Template (. 20.16) LabelFields ( ), .

    |LJLdlii>l lemtildte PART NO Lii.MLdltnil

    . 20.15. New LabelTemplate

    ^(DESCRIPTION|(DWG_SIZE)

    20.16. Label Template

    5. Label Fields Field List ( ) , . Add.

    20. 639

  • . , P a r tNo: PART_NO.

    , , .

    6. Label Offset ( ), . 20.17. , . Start , , AutoCAD .

    . 20.17. Label Offset Label Template

    7. Leader Offset ( ) X Y. , -, ( , , ).

    8. Tip Offset X Y. , , . - 0,0, .. .

    9. , Label Template .

    . Label Offset .

    -. dbConnect1^Templates^Edit Label Template ( ^^ -). Select a Database Object Con-tinue. Label Template - ( , ). - .

    . -

    . - , Data View. .

    1. Data View.

    640 III.

  • 2. Data View^Link and Label Settings^Create AttachedLabels ( ' ^ - ). , .

    3. Data View^Link! ( !).

    4. S e l e c t o b j e c t s : , .

    5. AutoCAD . - , ( - ).

    .

    , - . , .

    . , Data View. .

    1. , .

    2. Data View^Link and Label Settings^Create Free-standing Labels ( 11* - ).

    3. Data View^Link! ( !).

    4. Specify p o i n t for l a b e l : ( :) . AutoCAD 1 Record(s) l i n k e d with 1 Label (s)(1 () 1 ()).

    . , Data View^View Linked Ob-jects, AutoCAD .

    , , - . ; dbConnect^Labels^Reload Labels ( 1^ ). Select a Database Object .

    . 1. 20-1.dwg, -

    . Data View . , , .

    2. dbConnect^Templates^New Label Template( 1^ 11^ ).

    3. Select a Database Object ( ) Continue.

    4. New Label Template ( ) , Continue.

    20. 641

  • 5. Label Template ( ) LabelFields ( ). Field PART_NO - Add ().

    6. Field DESCRIPTION Add.

    7. Label Offset ( ). Start Top Left. X Y 2.

    8. Character. 5/16.

    9. .

    10. Data View^Link and Label Settings^Create Attached Labels (^ ).

    11. Data View^Link! ( ^!).

    12. S e l e c t o b j e c t s : - . . AutoCAD .

    13. . - . , . .

    14. . .

    Query Editor

    - SQL (Structured Query Language), .

    AutoCAD - Query Editor. , , :

    - ;

    ;

    , SQL.

    , Link Select ( ) -, SQL-.

    Query Editor .

    1. dbConnect^Queries^New Query (^ ).

    2. Select a Database Object , - , Continue.

    3. New Query ( ), . 20.18, ( , ). , . Continue.

    642 III.

  • ||H]jNew Ouerv

    1 : 1 records bated

  • , . Find Next, .

    Field, Operator , (=) (>). Value . , , Look Up Values ( , , ).

    . "" , "", - .

    !

    Indicate Records in Data View ( Data View) /Indicate Objects in Drawing ( ). -. , Store(), Execute ().

    Query Editor Return to Query - Data View.

    . 20.2 .

    (=) ,

    () ,

    (>) , ( , D , )

    (=) ,

    (

  • [JliQuefyLilitoi - CAH1 NO Oueryl

    -^ -^ 1 """ ~DESCRIPTIONDWG SI2E i, ..,.. . 1WADF/PIIR- '- LWKUP"**)UNITS

    J|lp -_! BmtKre |8E85-O73-O4]2|

    !

    * j

    - ' J -

    jtwc. .'I

    /*c. 20.20. Range Query -,

    Store Execute .

    Query Building Query Building ( ) -

    . , , DWG_SIZE D, PART_NO , 902 9-0 7 2 - 0 0 1 . () . , Data View ( ) . - - SQL.

    And , , - And.

    Or , , Or.

    . , - , And, Or .

    . 20.21 , .

    .

    1. Field ( Field ).

    2. Operator.

    3. Value ( - ).

    4. Logical , And. - Or.

    20. 645

  • PAR1 MO Oueiyi

    -iBBMHGreatel the 9076-052-002

    Equal thei 9665-092-000

    Equal D

    AndI Or

    And

    I" tdcta3QBOt1nl

    . 20.21. Query Building

    5. , , .

    6. . Field Value Logical . - , . , , .

    7. Store Execute -.

    , Data View ( ).

    ( -). Fields. Add . - , , ( ). , Show fields ( ) Clear All ( ). Clear Field Name ( ).

    , , Show Fields ( ). Add Sort By ( ). AutoCAD - ; Ascending/Descending( / ). . .

    Store Execute .

    SQL Query .

    SQL Query. SQL. ( - SQL! , - , , , Microsoft Office VBA.) . 20.22 SQL Query . 20.21.

    646 III.

  • |[E]QueiyEclilor _PART NO Oueivi

    SELECTPART NO. DESCRIPTION, DWG SIZE. "MADE/PUR11, UNITS FROM TART NO1 -IWHERE [PAfiT_NO>'13076-052002'J And ( DWG SIZE - B ) Or (RART_NU< >* Z41 Out'1 Arc I DWG SIZ

    . 20.22. SQL Query SQL-, -

    ^0^4^ AutoCAD 2002 SQL 92, . , ,

    SQL .

    SQL Query , , . Table Add. , , , SQL- .

    Prepare SQL- . Store Execute .

    SQL , , ,, .

    ( ').

    , .

    SQL, -. . : CHAR, GROUP, SQL, TABLE, USER CURRENT.

    SQL, - (;), ASE .

    "" AutoCAD DOS ( * ?) .

    , , .

    .

    SQL SELECT. - , .

    20. 647

  • SELECT, , - , .

    SELECT FROM [{,}...][WHERE ][GROUP BY [{,}...][HAVING ][ORDER BY [{/}...]

    . , , .

    :

    SELECT ;

    FROM , ;

    WHERE , ;

    GROUP BY . - ;

    ORDER BY - (ASC) (DESC).

    . 1.

    ab20-l .dwg Data View ( ). dbConnectoQueries^>New Query ( ^ ).

    2. Select a Database Object ( ) - Continue.

    3. New Query ( ) Continue, - Query Editor.

    4. . . , , 9001. , Range Query.

    5. Field PART_NO. 9001-000-000 9001-999-999. , , , , 9001.

    6. . Query Builder. - . , - Range Query .

    7. Logical , AutoCAD And.

    8. Field , DWG^SIZE.

    9. Operator. AutoCAD , .. , .

    648 III.

  • 10. Value. ( !).

    11. Execute. , .

    12. .

    Link Select

    Link Select ( ) - . QueryEditor , - . (, ), .

    , AutoCAD - .

    - ( , - , ).

    . 20.3 , - .

    [ 20.3.

    UNION () ,

    SUBTRACT - { -)

    SUBTRACT - ( -)

    INTERSECT () ,

    Link Select ( ) -, , .

    Link Select.

    1. dbConnect^Links^Link Select ( ^^) Link Select (. 20.23).

    2. Use Query ( -), Select in Drawing ( ).

    Use Query, Query .

    Select in Drawing, Select ( Execute) - S e l e c t o b j e c t s : . Link Select.

    3. Execute .

    4. , .

    20. 649

  • EJLink Select - al>2D 1

    ' FHK-I |1- ' " '. I1 I

    i

    n M i

    km- .

    1 * * | f ; >(

    +

    1

    d -

    Z J _ " 5

    J U N |

    i GUKI*

    Puc. 20.23. Link Select -

    5. Do . - .

    6. , . 5.

    7. Finish .

    , , -

    . ASE, - 13 14, AutoCAD 2000/2002.

    ,

    Store . dbConnect . dbConnectoQueriesOExecuteQuery ( ^^ ). , , . , , , - , .

    , dbConnect1^Queries^Edit Query ( ^1^ ). Continue. Store.

    dbConnect, , . -

    650 III.

  • , , -, , .

    dbConnect^Quer ies^Delete Query (^ ). ( ) .

    , Store Query Editor, -

    dbConnect^QueriesOExport Query Set ( ^1^ ). Export Query Set ( ) , Save. AutoCAD D a t a L i n k s AutoCAD 2000, . dbq.

    dbCon-n e c t ^ Q u e r i e s ^ l m p o r t Query Set ( "^ ). DBQ. Import Query Set - Open. ,AutoCAD 2002 , ( - ).

    AutoCAD 2002

    AutoCAD 2002 , , - AutoCAD 2002.

    , , -. . 20.24 - , .

    1. dbConnectLink Conversion ( "^ ).

    2. - R13/R14 R12.

    3. - . R13/R14 , ,, . R12 , .

    4. New Link For-mat ( ) - - , , , . - - , - . . 20.24. Link Conversion

    20. 651

  • 5. .

    6. , AutoCAD 2002, .

    , , - , AutoCAD. - AutoCAD , . , .

    SQL- - , . - , -. , , Auto-CAD 2002 .

    III . - .

    652 III.

  • IV .

    AutoCAD , . - , , , . , AutoCAD , - . - , , , -, , , , , . . ( ) (), . - , , - .

    21 , , () . - 22 . 23 , 24 -. 25 , AutoCAD 2000 - .

    I

    . 21. . . -.**

    22.

  • ?*

    "..1-; / ^ .* * " &

    ... V \.

    ;4- " ; i-: ..?/.;?

    . ;" :- **& .* .Jjj-^"'*;: '.

    . ; - . ;: *

  • , , . , , - , , AutoCAD - .

    . 21.2. ,

    , . (3,4) (5,7) , , (3,4,2) (5,7,6). , Z. . . . 21.3 X, Y Z, . , . - .

    , , - (. , Z) . Z - . , - (2,3,8), Z, .. (6,7). Z 21.3. 8.

    21. 655

  • LINE () . , - X, Y Z .

    ^ (), 8, " - 4 ".

    AutoCAD

    , . , - , - AutoCAD . . 21.4 - , , - (, , ). , ., - Z 0. , - .

    . 21.4. , -

    656 IV.

  • , . , - , . 21.4, (3,2,1) - (6,4,3), 3,2,1, @3,2,2, - (6,4,3) (3,2,1).

    , -

    . . , .

  • , ( ) ( ). X XY, XY Z. . @. . 21.6 , .

    5 @5

  • ab2l-a.dwg, - Drawings -.

    . 1. ab21-a . dwg -.

    2. ab21-l .dwg AutoCAD Bible.

    3. Rectangle () Draw(). Specify f i r s t c o r n e r p o i n t or[Chamfer/Elevat ion/Fi l le t/Thickness/Width] : ( - [////]:) 0,0,19

  • 7. OSNAP () . - Endpoint ().

    8. LINE (), :

    Specify f i r s t p o i n t : 1 . 21.1Specify next po int or [Undo]: 0,0,0

  • . 21.8. -

    ,

    , , . . , , " "; X, Y, Z . , AutoCAD , .

    4, " ", -

    . . . , X . , . - ., .xz .yz. , , 3 Z -, . . Z, .

    .

    AutoCAD - . , , - . , , . , . - Apparent Intersection ( ) . , .

    21. 661

  • . -

    . , - , .

    ,/J" s ;.^, ab21.~b.dwg, -(- Drawings -.{ ,- - ''*

    .

    1. ab21 - b . dwg -.

    2. ab21-2 .dwg AutoCAD Bible. - ( OSNAP ). Endpoint. , , . , .

    3. Stretch () Modify(). . . Speci fy basep o i n t or d i s p l a c e m e n t , or [ M u l t i p l e ] : ( []:) 1, . 2\.9. Specifysecond p o i n t of d i s p l a c e m e n t or

  • 5. LINE, :

    S p e c i f y f i r s t p o i n t : 2 . 21.9

    Specify next point or [Undo] : -xy

  • . , Z, . XY. - , .

    , , - . - XY, , , . , CIRCLE () - .

    , , P L I N E (). 3DPOLY (). 3DPOLY PLINE, :

    ;

    ;

    .

    3DPOLY . , - PEDIT (), .

    , , -

    . .

    . . 21.10, ,

    , . , . , - . , , ..

    , . AutoCAD

    . , -, . . 21.11 , .

    , , 2 /2~. , .

    (tessellation lines). AutoCAD , . , -, .

    .

    , Properties () . ( -, ). Properties, -, Thickness ().

    664 IV.

  • . 21.11. ,

    . ELEV ()( - ). . ELEV - , .

    - Z. - Z. .

    , . . , -

    , , -\ Properties. ,

    , .

    HIDE , -

    , HIDE () , - . , , . . 21.12 , . 21.11, HIDE. , , - . ?

    RECEN ().

    : H A L O G A P , O B S C U R E D L T Y P E

    O B S C U R E D C O L O R , -

    ''"'. H I D E .!

    21. 665

  • . 21.12. HIDE

    HIDE H i d e SHADEMODE. - , . , - .

    HALOGAP. , HIDE. - . , HALOGAP 0, . , 100% (2,54 ). .

    OBSCUREDTYPE. , , ( ), . - , -, , . :

    0 ( );

    1 ( );

    2 ( );

    3 ();

    4 ( );

    5 ( );

    6 ( );

    7 ( );

    8 ( );

    9 ( );

    10 ( );

    11 ( ).

    666 IV.

  • OBSCUREDCOLOR. , , - ( ), - . , , - . , - I 255, -. OBSCUREDCOLOR , - AutoCAD ( 1 255). : 1 (), 2 (), 3 (),4 ), 5 (), 6 (-) 7 (-).

    . 21.13 , HALOGAP 10, - OBSCUREDLTYPE 2 ( ). - OBSCUREDCOLOR 1, .

    . 21.13. , , HALOGAP, OBSCUREDLTYPE OBSCUREDCOLOR

    !

    i

    I

    H I D E T E X T HIDE. , , , HIDE , . - off, .

    {wireframe, ) AutoCAD - . -, , . , . , , . -, - , , , . 21.11. , , . . , .

    21. 667

  • ?

    . 21.12 , , . AutoCAD, , , .

    , , SOLID ( ), .

    , RECTANG () POLYGON (-) , . , L I N E ().

    , , S O L I D () R E G I O N ( ) .

    (, SOLID.) .

    ,

    XY. , - Z, . , , - . , XY. ( XY.) (elevation), Z.

    , :

    Elevation() Properties (), - ;

    MOVE () () Z.

    ELEV () - .

    Z Properties (). , , , . Z .

    . , XY.

    !

    , ( Z), - . AutoCAD , . , , , , , - , . , - , .

    68 IV.

  • . , HIDE1. , Start from Scratch ( ).

    2. ab21-3.dwg AutoCAD Bible .

    3. CIRCLE (). (6,6) - 18.

    4. ZOOM E x t e n t s .

    5. Properties () . - . Thickness () Properties 3.000 . Properties .

    6. elev

  • () 8, " ". , . , .

    , . XY . , . 21.15 , XY. - , XY?

    : , - XY . - , XY. , , - XY .

    ,

    . - . : Origin( ), "" AutoCAD - , . ViewODisplay1^UCS Icon^Origin (=>1^ ^).

    20001, . |^ .

    8, " ".

    .

    , ( ), - , , , X. X, Y Z ( ) . - . .

    , -

    , , XY . , ( XY), , , - . - XY. . AutoCAD , , XY .

    . 21.15 : P l a n v i e w ( ), SE I s o m e t r i c v i e w ( )

    670 IV.

  • AutoCAD . . : ( ) - , . - (SE I s o m e t r i c view), , . .

    . 21.15. - . , UCS

    21. 671

  • UCS , ,

    Tools^New UCS (^ ). - .

    OBject . -

    , . - XY OBject (). XY - . , - 3DFACE (3-). . 21.1 , - .

    21.1. Object

    . X -

    . X

    . X X,

    , X - .

    , X -

    . X

    . X , -

    . X

    , X -

    , X - . Y -

    . XY

    Face Face ()

    () . S e l e c t face ofs o l i d o b j e c t : ( :) . AutoCAD X - , .

    672 IV.

  • Enter an o p t i o n [Next/Xfl ip/Yfl ip] < a c c e p t > :( [//] :) - . Next() "" ( , AutoCAD). , , . - Xflip (), 180 X. -, Yflip (), - 180 Y. , , .

    View View () X .

    . View -, , .

    Origin Or ig in () , ,

    , . .

    Z Axis Vector 2 Axis Vector (Z ) , -

    Z. , .

    3Point 3Point (3 ) .

    , - X, ( - X). - Z X .

    X X (-) Z

    X . 90 , 90, .

    Y Y (Y-) X Z

    Y. .

    Z Z (Z-) X

    Z. .

    21. 673

  • ab2l-c.dwg, - Drawings -.

    . 1. ab21-c.dwg -.

    2. ab21-4 .dwg AutoCAD Bible. - , - . ( OSNAP ). Endpoint Quad-rant. .

    3. Circle () Draw (). - From () @2, , 1 (. 21.16). 0.5.

    674

    . 21.16.

    4. Properties () , . Properties Thickness () 16. Properties.

    5. ORTHO () , -. Mirror () Modify(). . 2 . 2 . AutoCAD .

    IV.

  • 6. MIRROR. . Midpoint (
  • Y=0.0000 Z=7.0000. ( 0,0,0) , .

    14. , . Tools^New UCS^Origin (1^ ^). O r i g i n p o i n t < 0 , 0 , 0 > : ( :) 0,0,7

  • A gtoss-bottomed chair

    . 21.18.

    ,

    , . - , .

    .

    21. 677

  • ... .".'

    ^

    3D Orbit \

    _ , .:.;.

    -

    -. () .

    (). . . - , , -. ? , , - , . . 22.1 , . 22.2 . , . 22.1 , . , , , .

    - .

    ZOOM Previous ( -) -.

    .

    ZOOM Real t ime( ) PAN Real t ime( ), ZOOM - .

  • ( ( ( ) )

    -..__ i

    0

    " L _ . _

    /*. 22./. , .. . (Robert Mack), Dexter Company, , .

    . 22.2. - HIDE

    0'

    G

    AutoCAD , View (). , - . - . , - , . , , .

    , -, View, -, ViewO3D Views(^ ), - . - ZOOM E x t e n t s .

    22. 679

  • VPOINT -

    View VPOINT () X, Y Z. AutoCAD VPOINT - . , AutoLISP, - .

    VPOINT X, Y Z. 0, 1. - .

    , .

    VPOINT R o t a t e (), Viewpoint Presets ( ). DDVPOINT (). : X XY ( - - ) XY ( ).

    , . - .

    _****** UCSORTHO, , , -

    ( , , , , ). - , - UCSORTHO ( 0).

    - (. 22.3). -- . Top View ( ) -

    View View^3D Views. - VPOINT {0,0,1).

    , 1

  • . 22.3.

    5:: . ^^ , - . Bottom View ( ). VPOINT (0,0,-1). . 22.4 . .

    . 22.4.

    |5 : , , (. 22.5). iSs i . - Left View ( ). VPOINT (-1,0,0). - , - , .

    22. 681

  • . 22.5.

    \:7\' (. 22.6) . , -L- . Right View ( ). VPOINT (1,0,0). -, , .

    V.

    N o r t h s i d e

    . 22.6.

    VfA'z ( , -------- ) , - (. 22.7). Front View (). VPOINT (0,-1,0). 1 , - "" . , AutoCAD. - .

    682 IV.

  • F r o n t

    ( E a s t )

    . 22.7.

    (. 22.8). , -^ " ^ . Back View ( ). VPOINT (0,1,0).

    . 22.8.

    - | | | j j - (SW) - (. 22.9). , , , , . . , , . - SW Isometric View ( ). - VPOINT (1,-1,1).

    22, 683

  • z.

    . 22.9. -

    ( : - ). , AutoCAD , -. AutoCAD X 0. - .

    - ; : - (SE) L (. 22.10). - , . , - . , , , . - SE Isometric View ( ). VPOINT (1,-1,1).

    . 22.10. -

    684 IV.

  • - igvf - (NE) , (, 22.11). NE Isometric View (CB ). VPOINT (1,1,1).

    . 22.11. -

    - |1=? - (NW) -fu.-m , (. 22.12). - NW Isometric View (C3 ). - VPOINT (-1,1,1).

    . 22.12. -

    22. 685

  • DDVPOINT ,

    DDVPOINT (). V i e w ^ D Views1* ViewpointPresets (^ 1^) - Viewpoint Presets ( ), . 22.13. .

    - - XY X. - :

    270090

    180

    , 22.13. View-point Presets

    . , 315 . , - - , .

    - Z. 0 , , , - , 90. 0 90 .( , XY 35.3.)

    . - , ,

    , , - : - 47.6.

    , - .

    . - , , , , .

    , -. .

    Set to Plan View ( ). , .

    , . , . , - . , - Relative to UCS ( ).

    686 IV.

  • , . , .

    , .

    ab22-a.dwg, - Drawings -.

    . DDVPOINT1. a b 2 2 - a . dwg -.

    2. a b 2 2 - l . d w g AutoCAD B i b l e . - , .

    3. ucsortho

  • J _

    Front(East)

    . 22.14.

    14. . , . 22.14.

    15. USCORTHO, uscortho ). (. 22.15).

    VPOINT ( ) C u r r e n t view d i r e c t i o n : VIEWDIR=-1. 0000,-1.0000,1.0000 Speci fy a view p o i n t or [Rota te ] < d i s p l a y compass andt r i p o d > : ( : VIEWDIR1.0000,-1.0000,10000 []

  • . 22.15. VPOINT

    , . , , .

    , - ( ). XY .

    .

    X Y. X - , . , - X - . - Viewpoint Presets ( ) , .. XY X. , . , :

    X ;

    Y ;

    X ;

    Y .

    , . , .

    . . X Y . : , .

    22. 689

  • , - , . . 22.16 , , . 22.17. - .

    . 22.16. , - . 22.17

    . 22.17. , . 22.16

    AutoCAD(Michae Garrison Associates, Fresno, CA)

    Michael Garrison Associates , , .

    690 IV.

  • - , Michael Garrison Associates .

    : " ( ). , , - . - , , . , , , , , ". , Michael Garrison As-sociates , . .

    " , . , , - , -. - , CADP2, JBLProfessional, , . . - , , ". , . . -, .

    " , Accurender (Robert McNeel & Associates,, . ) . ( ) . , -, . - -. ."

    22. 691

  • . .

    PLAN . ,

    plan

  • World (MCK) , . , Current UCS .

    . 22.18 . , , , .

    Enter UCS name(s)Current ucs name:Saved coordinate"EASTEIEV"

    Origin - < 0'V Axis :

    O'-O">.O'-O">,

    0'-0">-0 7/16

    4'-0">0'-0">,

    Axis -Z Ax i s -

    , X Ais\0'-0">,

    , X AKis2 Axis -

    < 0 ' - 0" . t

    '-0",0'-l">

    . 22.IS.

    , UCSFOLLOW. , . , , - , , .

    , , - , Z - . , .

    0 (). , - . , . ucsfollow

  • F r o n t

    2 ( E a s t )

    . 22.20. . ,

    . 22.21.

    . 22.22. , - . , !

    4. vpoint

  • 5. plan-

    ) shademode

  • Gouraud Shaded, Edges On ( ). . - , , , , .

    HIDEPRECISION FACETRATIO - , . HIDEPRECISION 0. - . - 1. , . FACETRATIO , . 0, . , 1, , - , -, .

    25, " -

    ", . Auto-CAD, . , . , , .

    A u t o C A D 2000i S H A D E M O D E . . , -

    - -! . 3D Orbit.

    , 3D Orbit SHADEMODE, , - " ", , - LIGHT. , 3D Orbit SHADEMODE, / . , , , . 25, " ".

    .

    1. Tools Options ( "^) System ().

    2. Current 3D Graphics display ( ) - , ( , AutoCAD). Properties ().

    3. 3D Graphics System Configuration ( ) Render Options ( ).

    696 IV.

  • 4. Transparency (); High Qual-ity/Slower ( ()), Medium Quality ( ) Low Quality/Faster ( ()).

    5. Apply & Close ( ).

    6. Options.

    , 25, " ". , , , - . . 22.24 ( ) - Gouraud shaded ( ).

    . 22,24. , Brassy Valley Gouraud shaded.( , !)

    a b 2 2 - c . d w g , - Drawings -.

    . 1. 22-- dwg -.

    2. ab22-2 . dwg AutoCAD Bible.

    3. Tools^Options (^) System ().

    4. Current 3D Graphics display ( ) , ( , AutoCAD). Properties ().

    5. Materials () Enable Materials ().( , AutoCAD ( Heidi), .)

    22. 697

  • 6. Apply & Close ( ). Options.

    7. View^Shade^Flat Shaded(^^ ). , - .

    8. ViewOShadeoGouraud Shaded (^1^ ).

    9. , ViewO ShadedGouraud Shaded, Edges On (=>1^ ).

    10. . , . 22.25.

    . 22.25. , - Gonraud Shaded, Edges On

    3D Orbit 3D Orbit

    (), "" . 3D orbit, , . , 3Dorbit, AutoCAD - . . - .

    , . , .. , 3D orbit , .

    , , - . AutoCAD , - . : 3D Orbit .

    698 IV.

  • DVIEW, .

    3D orbit

    3D orbit 3D Orbit, . - (arcbail AutoCAD), . 22.26.

    !

    . 22.26. AutoCAD 3D orbi t

    AutoCAD 2000i, 3D Orbit , .. . - , 3D Orbit - , , , , 3D Orbit. Auto-CAD .

    . - 3D orbit , . , - .

    3D orbit AutoCAD - - . , , - . , . - " , , , -?", . , - . .

    22. 699

  • circular arrow-,. L _ . , {circular arrow). -, c i r c u l a r arrow. - ( - ) , . . AutoCAD roll (). . 22.27 0, 90, 180 270. , . , . , , , . AutoCAD - , , .

    0

    . 22.27. circular arrow

    700 IV.

  • sphere and lines1 -% -

    "' - , , a small sphere encircled bytwo lines (.. ). s p h e r e and l i n e s . - , , , , - . , - AutoCAD, , . .

    , -, , , , .

    , , - ( ). - .

    - , , - . , 360. , , .. . , , - , , . , -, , , . . 22.28 s p h e r e and l i n e s . .

    % -

    -3 , , ( - horizontal ellipse cursor). - , - , . - , . , , - , . - . , , . . 22.29 - .

    2Z 701

  • . 22.28. sphere and lines

    . 22.29.

    702 IV.

  • ;,.?. -. _ , , ( vertical ellipse cursor). - , , . - , . , -, , . "" ., , . . 22.30 .

    . 22.30.

    3D orbit 3D orbit

    . - .

    22. 703

  • Visual Aids 3D orbit. Visual Aids , , .

    Compass (). - , , , X, Y Z. - . Visual AidsoCompass .

    Grid (). , XY. - Z ( - ELEVATION). 10, GRIDUNIT. - Drafting Settings ( ). - , , , .

    3D UCS icon (3M ). - . X , Y , a Z .

    . 22.31 . - . , "" , - .

    . 22.31. 3D orbit ,

    ( , - 2D wireframe),

    3D orbit. -, 2D wireframe - 3D orbit .

    ,

    3D orbit, . (.. ) , . , - . , AutoCAD.

    .

    704 IV.

  • 1. 3D orbit More Continuous Orbit(^ ).

    2. , s p h e r e a n d l i n e s .

    3. . -. , , .

    , - . , , .

    Pan, Zoom Orbit. Zoom Previous - 3D orbit , .

    3D orbit -

    , . AutoCAD , , - . , , 3D orbit, Reset View ( ).

    3D orbit

    3D orbit , . ( ), - , , -, , - , , - ( 25," ").

    3D orbit -, 3D Orbit.

    3D orbit 3D orbit Pan

    (). - . . , Orbit, Zoom.

    -, .

    3D orbit 3D orbit

    Zoom. - " + " "". . - Orbit, Pan.

    -, .

    22. 70S

  • 3D orbit

    3D orbit , ZOOM Window. 3D orbit ( MoreOZoom Window(^ )). -. , , , . - , .

    , (drawing extents), 3D orbit - More^Zoom Extents ( ).

    Z 3D Orbit -

    . " ".

    AutoCAD 2000i, ,\ Orbit Maintains Z ( Z ),

    ~ ! * Z .! ,

    .

    , . , , , .

    3D Orbit - More^Orbit Maintains Z ( - Z ). . , AutoCAD , .

    ,

    , . , . , - (camera distance), - , , , .

    3D orbit More^Adjust Distance (^ ). - ( ). , , "" , . , - "", . .

    ,

    AutoCAD . ,

    706 IV.

  • , , . - 3D orbit.

    CAMERA (), -. S p e c i f y new camera p o s i t i o n < - 4 1 . 0 4 9 4 , 1 2 9 . 5726,5 6. 6 4 3 7 >: ( :) AutoCAD . -. S p e c i f y new camera t a r g e t < 2 0 . 8 9 3 7 , 6 7 . 6 2 9 5 , -5.2 9 93>: ( :) .

    - . -

    po int . - Node () .

    3D Orbit Properties Manager -

    , .f AutoCAD 2000I

    \ " 3D Orbit. -- - View Height ( ) View Width ( ).

    !

    . -, . , , .

    . . - , , - { ).

    - Properties Manager. .

    3D orbit ( ) -

    . , , , , - . - ( ). - , , ,. , . - . . - , - .

    3D orbit Projection^ Perspective (1^ ). - ProjectionOParallel (1^). .

    22. 707

  • " 3D orbit, , , , -

    . . 3D orbit . - , 3Dorbit Projection Parallel. 3D orbit.

    3D orbit, -

    , , , . , . 3D orbit. Preset Views( ), .

    , ,

    , , , . , AutoCAD. -, .

    AutoCAD 2002 Adjust Clipping P l a n e s ( ), - , - .

    (.. ). - . , () , ( Front). , "" , .

    1. 3D orbit M o r e 1 ^ Adjust ClippingP l a n e s ( ) . - Adjust Clipping P l a n e s (. 22.32).

    2. .

    Adjust Front Clipping ( ). - . , -, .

    j25j]1 Adjust B a c k Clipping ( ). 1 .

    , , - .

    C r e a t e Sl ice (). - . .

    Front Clipping On/Off (/ ). / .708 IV.

  • Adjust Clipping Planes

    -

    -

    . 22.32. Adjust Clipping Planes

    :=| Back Clipping On/Off (/ ). I / .

    3. , Adjust Back Clip-ping , . , , Adjust Front Clipping.

    4. , , Close . , , .

    / More^Front Clipping On ( ) More^Back Clipping On (^ ). , .

    . 22.33 , , . 22.32, - . .

    , , -

    3D orbit. , Shading Modes ( ) . 3D orbit.

    22. 709

  • , Shading M o d e s tWireframe. 3D orbii - View (), .

    . 22.33.

    ab22-d.dwg, - Drawings -.

    . 3D Orbit1. a b 2 2 - d . d w g -.

    , NW isometric ( ).

    2. 3D Orbit . - .

    3. . - , . , .

    4. . , . . . - . " ".

    5. . - s p h e r e a n d l i n e s , . . - , - . - .

    710 IV.

  • 6. Shading ModesOHidden( ) .

    7. More^Continuous Orbit ( ) . - . - .

    8. Orbit . .

    9. Reset View ( ) . , .

    10. Pan () - . .

    11. Zoom () -. .

    12. ProjectionOPerspective (1^) . , , - . , , . . Projection^Parallel (^) .

    13. Preset Views^NW Isometric( ) .

    14. , 3D orbit.

    .

    8, " ", -

    . - . , - , - . .

    AutoCAD , -

    . DVIEW (). , 3D orbit "" DVIEW, .

    3D orbit, DVIEW ( - ). , - , ( target point), .. -

    22. 711

  • , . , , , - , .

    DVIEW () . . 22.34 (). - . . 22.35 . - , , .

    . 22.34. , DVIEW. : (Robert Mack), Dexter Com-pany, , .

    . 22.35.

    DVIEW , DVIEW

    (). S e l e c t o b j e c t s or : ( :) , .

    712 IV.

  • , , . , all^ ().

    , , . AutoCAD dviewblock, - . , - , .

    dviewblock. - X, Y 2.

    s e l e c t o b j e c t s o r < u s e D V I E W B L O C K > : , - , AutoCAD .

    DVIEW -

    :

    Enter option[CAmera/TArget/Distance/POints/PAn/Zoom/TWist/CLip/Hide/Off/Undo]:

    , .

    CAmera () , -

    . , "" (). , , , - . XY X XY. DDVPOINT (), .

    :

    Specify camera l o c a t i o n , or e n t e r angle from XY p l a n e , or [Toggle(angle in) ] :

    , , DVIEW. XY , . . . . - .

    , X XY. , . Toggle angle in ( ).

    Toggle angle in ( ) - . CAmera:

    Specify camera l o c a t i o n , or e n t e r angle in XY p lane from X ax i s ,or [Toggle (angle from)] :

    X - XY. , . , . - .

    22. 713

  • XY, - , T o g g l e . . . .

    . Enter angle in XY plane from x" a x i s : ( XY X:). ,

    XY, AutoCAD . XY CAmera.

    TArget Target ()

    . T a r g e t () CAmera. , , . , , ( ) .

    CAmera, T o g g l e . . . ( ) - , .

    Distance D i s t a n c e () ,

    . , , -. D i s t a n c e (.22.36). , .

    ) 0> 1

    a

    J/ Ax lex |

    . 22.36. Distance

    Speci f new c a m e r a - t a r g e t d i s t a n c e : ( :). - . . 4 ZOOM () 4. 1

    774 IV.

  • . -, 1 .

    , , - .

    POints Points

    (). Specify t a r g e t p o i n t : ( :). , . AutoCAD - " ", . - . Enter camera point : ( :) . " " , .

    , , , - .

    , - -

    . , -; w | . DVIEW

    Format&Point Style (^ ) - . ( Z) ELEV(). , Point () Draw () . . Points - Node (), .

    Points , , - Distance, .

    DVIEW PAN () ZOOM

    (). DVIEW PAN ZOOM -. Specify displacement base p o i n t : ( - .) . Specify secondp o i n t : ( :) , - . .

    Zoom Zoom () ,

    Dis tance. , Specify zoom s c a l e f a c t o r : ( - :), , D i s t a n c e . , Speci fy l e n s l e n g t h: ( :}. , 35 , . - , 70 , , .

    22. 715

  • 50.0000 , , .

    TWist T w i s t ()

    ( ). 0, .. . , , 180 , . " " , . .

    CLip C l i p () ,

    . , , . , - AutoCAD. , . - , .

    . 22.37 22.35. . 22.37 , .

    . 22.37. . . 22.35

    C l i p B a c k / F r o n t / < O f f > : (//:). Back () F r o n t () , , . OFF .

    ^00^" Distance - .

    716 IV.

  • Front Speci fy d i s t a n c e fromt a r g e t or [ s e t to Eye (camera) ] : ( [] :). Eye () . , , . - , .

    Back Speci fy d i s t a n c e from t a r g e tor [ON/OFF] : ( [/] :). - ON OFF, , . - , .

    Hide Hide () HIDE ()

    , .

    Off Off () -

    . DVIEW , , , DDVPOINT () VPOINT (). , , , . DVIEW .

    Undo Undo () , -

    DVIEW. Undo, - , DVIEW.

    eXit e x i t () DVIEW.

    , , .

    ab22-e.dwg, - Drawings -.

    . 1. ab22-e. dwg -.

    2. ab22-3. dwg AutoCAD Bible. (. 22.38). ( OSNAP () ). Endpoint ().

    3. 1 ( ) 2(. . 22.38). , 1 . - , Distance () Inquiry () 3 4. AutoCAD D i s t a n c e = 12 ' -5 9/16". -, , . - , , .

    22. 717

  • X

    . 22.38. , . (Andrew Wil-). Virtual Homes. Inc., , ,

    4. NE Isometric View ( ) View(). . 22.39. . . . LINE (). 1 . 22.39. . - 2 . . LINE, .

    X

    . 22.39. -

    5. View=^3D Dynamic View (^ ). S e l e c t o b j e c t s or : all

  • 6. DVIEW Points () . Speci fy t a r g e t p o i n t : ( :) 1.

    7. Distance () . Specify new c a m e r a - t a r g e t d i s t a n c e:) 13'

  • . 22.40.

    AutoCAD AutoLISP, - , SOLVIEW, SOLDRAW SOLPROF. Solids (').

    SOLVIEW

    SOLVIEW () - .

    | -| SOLVIEW, Setup View (: ) Ll^i Solids (). SOLVIEW .

    UCS () , -, . . . . . , . . , . , . - . E n t e r view name :( :). . - , , ( ), B'ront () East E l e v a t i o n ( ). .

    720 IV,

  • Ortho () . - Specify s i d e of v iewpor t to p r o j e c t : ( :) . , . . , - , . ZOOM E x t e n t s ( ). - . , .

    A u x i l i a r y () . Specify f i r s t p o i n t of i n c l i n e d p l a n e : ( - :) . Specify second p o i n t of i n c l i n e d p l a n e : ( - :) . - . Speci fy s i d e to viewfrom: ( :) . , .

    S e c t i o n () . Speci fy f i r s t p o i n t of c u t t i n g p l a n e :( :) . - Speci fy second p o i n t of c u t t i n g p l a n e : ( :) , - . , , , , .

    e x i t () SOLVIEW. , , . - .

    . 22.41 , , .

    L _ - I. 22.41. SOLVIEW

    22. 721

  • SOLDRAW

    SOLDRAW () , SOLVIEW, , , . SOLDRAW SOLVIEW.

    SOLDRAW, Setup Drawing (:) Solids (). - . ( ). . - . . 22.42 . . SOLDRAW - . HATCHEDIT . 22.42. -() SOLDRAW

    SOLVIEW . SOLDRAW , -

    , . , SOLVIEW , -, . FRONT, TO FRONT-DIM. .

    SOLPROF

    SOLPROF () SOLDRAW, SOLVIEW. , SOLPROF , SOLDRAW. , Setup Profile Solids. - .

    0 " * S O L P R O F , , .

    Display hidden p r o f i l e l i n e s on s e p a r a t e l a y e r ?[Yes/No] : ( ? [/] :) Y N. Yes () , . , , .

    P r o j e c t p r o f i l e l i n e s onto a p l a n e ? [Yes/No]: ( ? [/] :) Y N. Y, . .

    722 IV.

  • D e l e t e t a n g e n t i a l edges?[Yes/No] : ( ? [/]

    :) Y N. , .

    . 22.43 SOLPROF. - . .

    . 22.44 SOLPROF , - . Ph-2dO. -, , ""(hidden). - , , "" .

    . , SOLVIEW SOLDRAW, SOLPROF .

    ,

    / , - -

    .

    . 22.43. , SOLPROF

    . 22.44. , - SOLPROF, - ,

    . -

    , View (). , DDVPOINT (). . PLAN () . .

    . - , . - , , - , .

    DVIEW () . . . , .

    .

    22. 723

  • .;1 !> &*' : .& ; ^^^;3DFACE . - ^ - f c A - J - -IOJV-

    ".- 1

    PFACE'"'

    .,. ' j'V.3DMESH - -:, ' ?.'

    " ..'

    TL1."

    './: -,;, . i\ s

    '* ;',. #. ; '''

    . -!

    , -, - . : . -. , - . . 23.1 - .

    , .. -

    . - , .

    - - , - - - . AutoCAD ( ) , -. . 23.2 - .

    . 23.1. . -

    - - Surfaces

  • (), . 23.3. , Surfaces.

    . 23.2.

    2D Solid Pyramid Revolved Surface

    Box Sphere Dish Edge | Ruled Surface

    Edge Surface

    3D Face Cone Torus Tabulated Surface

    . 23.3. Surfaces

    3DFACE

    . 21," ", , , - SOLID (), - , . , SOLID , Surfaces.

    - , REGION (). , , , . HIDE () - . , - , , , .

    23. 725

  • 3DFACE (3-), - . 3DFACE - . . , - . , - , . . , 3DFACE -. , 3DFACE , . EXTRUDE () . ( .)

    3DFACE$ , 3D!?- Face ( ) Surfaces (). - , , . , " ", - SOLID (). - .

    Specify f o u r t h p o i n t or[ I n v i s i b l e ] < c r e a t e t h r e e - s i d e d face>: ( [] :), . , .

    . Speci fy t h i r d p o i n t or [ I n v i s i b l e ] < e x i t > :( [] :). , .

    , - . Specify t h i r d p o i n t or [ I n v i s i b l e ] : Specify fourth p o i n t or [ I n v i s i b l e ] < c r e a t e t h r e e - s i d e d face>: , .

    , , - , . .

    , - , , -

    . -4 , **""' .

    , Frames Const.

    .

    . , . . 23.4 - .

    726 IV.

  • . 23.4. - . .

    .

    Invisible () , . , . , , .

    EDGE

    EDGE (). EDGE , . , , - .

    Edge () Surfaces (). jtfeja Specify edge of 3dface to t o g g l e v i s i b i l i t y or[Display] : ( , , []:) , . -, . , , , , EDGE .

    , Display () - . - E n t e r s e l e c t i o n method for d i s p l a y of hidden edges [ S e l e c t / A l l ]: ( [/] ; ). , , S e l e c t , ( ).

    23. 727

  • . Specify edge of 3dface to t o g g l e v i s i b i l i t yor [Display] : ( , , [];) , , . , .

    , ( )

    , Properties(). , , Prop-erties . Proper-ties , . 23.5.

    . -, -, , .. . - 1, 2, 3 4. -, - EDGE () , Properties - . EDGE.

    . 23.5. -, Properties

    - , . \Software\chap23\3dhouse3.

    SPLFRAME SPLFRAME 1, -

    , . ( - SPLFRAME , - .) SPLFRAME 0 -, .

    ab23-a.dwg, - Drawings -.

    . 1. ab2 3-a.dwg -.

    2. ab23-l.dwg AutoCAD B i b l e . . . -: (ORTHO () OSNAP () ).

    728 IV.

  • Endpoint () Midpoint(), Surfaces () -, - Surfaces.

    ~ 3. 3D Face ( ) Surfaces. - :

    Specify f i r s t point or [Invis ible]: 6,6

  • . 23.6.

    8. , Const. LINE () 2 (. . 23.6) @18 : 1 . 23.6Specify p o i n t on pos i t ive-Y p o r t i o n of the UCS XY plane : -

    10. LINE . :

    Specify f i r s t point: FromBase point : - : @3,-3

  • . 23.7.

    11. , . 23.7.12. 0. 3D Face (3M ) -

    Surfaces. :

    Specify f irst point or [Invisible]: 1 . 23.7Specify second point or [Invisible]: 2 . 23.7Specify third point or [Invisible] : 3Specify fourth point or [Invisible] : 4 . 23.7. - 2 3 4Specify third point or [Invisible] : - Invisible . - 5 . 23. 7Specify fourth point or [Invisible] : 6Specify third point or [Invisible] : - Invisible . - 7Specify fourth point or [Invisible) : 8Specify third point or [Invisible] : - 1 . 23. 7Specify fourth point or [Invisible] : 2Specify third point or [Invisible] :

  • ). . .

    14. T o o l s ^ N e w UCS^World ( ^).

    15. View^>3D Views Viewpoint Presets (^ 1^) - Viewpoint Presets ( ). From: X Axis ( X) 200. XY Plane angle( XY) 35. .

    16. ViewOHide ( ). - HIDE (), -. , .

    17. . , . 23.8.

    . 23.8.

    PFACE

    PFACE () (polyface mash). AutoCAD , PEDIT () . -, . PFACE -, AutoLlSP. - - . .

    , - 3DFACE (3-) , - .

    .

    , , , .

    732 IV.

  • .

    , . - - .

    , . . 23.9 : , .

    . 23.9. , . HIDE

    PFACE , -. ( ). , ( ) . - , . , . , .

    1. pface

  • 6. , , - , - .

    7. , - (.. ) . Face 2, v e r t e x I : E n t e r a v e r t e x number or [ C o l o r / L a y e r ] :( 2, 1: [/]:) - . - . . .

    PFACE, -

    . , - . , -

    . , .

    PFACE . , .

    - .

    ab23-b.dwg, - Drawings -.

    . 1. ab23-b. dwg -.

    2. ab23-2 .dwg AutoCAD Bible . - ; 24 ; - Const (. 23.10).

    3. pface

  • z1

    < Y

    "*X

    8

    / 3

    / 2

    9 _ _ _

    //

    - . . ^

    _

    7

    - 4

    _ -

    1 0

    - " - ' " ^

    5 )

    e /

    /

    1 2

    1 1

    . 23.10. ( )

    Face I, vertex 1: Enter a vertex number or [Color/Layer]

    Face 1, vertex 2: Enter a vertex number or [Color/Layer]

    face>: 2: 3

  • face>: 4
  • . -

    _ -

    _ -

    _ - -

    /

    /

    . 23. .

    3DMESH

    3DMESH (3-) - (polygon mesh) (MxN) ( - , PFACE(3-)). 3DMESH . - , AutoCAD , -, PEDIT (), -. . 23.12 , 3DMESH. PEDIT.

    . 23.12. , 3DMESH. - Smooth PEDIT

    23. 737

  • 3DMESH 3D Mesh ( ) - Surfaces (). Mesh M s i z e ( :) Mesh N s i z e ( N:). -, a N . . 23.13 , =5, N=3.

    . 23.13. =5, N=3 -

    -. , . 23.13 15 , - . , - (0,0). (0,1) . (1,0) , , . , , . , . 23.13, (4,2).

    . 23.13 - , . . -, , , (0,1) (0,2), . (0,1) (0,2) , (0,0) 5x3, . , - MxN .

    AutoLISP. AutoCAD. - .

    , , - PEDIT (). . Enter anopt ion [ E d i t ver tex/Smooth surface/Desmooth/Mclose/Nclose/Undo] ( [// .//]:). . 23.1 - .

    738 IV.

  • - 1.

    E d i t v e r t e x()

    Smooth surface

    ()

    Desmooth( .)Mclose()

    Nclose

    Undo ()

    C u r r e n t v e r t e x ( 0 , 0 ) . Enter an o p t i o n[Next/Previous/Left/Right/Up/Down/Move/Regen/eXit] :( (0,0). [// -// ////] :). Next,P r e v i o u s , L e f t , R i g h t , Up, Down - , . Move() . REgen () , e x i t()

    -, . -. SURFTYPE. SURFTYPE 5, b- ; 6, - b- ; 7, . (SURFTYPE=6). , -

    , -

    ,

    N,

    3DMESH (-) . , - . , - . . . (, , MxN.) - , . , , @0,0,100.78

  • 3D Objects

    . 23.14. 3D Objects

    . 23.15 ( AutoCAD BOX ())

    - HIDE.

    . 23.15. -

    .

    ' 1. Box () Surfaces ().

    ~ 2. S p e c i f c o r n e r p o i n t of box : ( :) .

    3. Speci fy l e n g t h of box: ( :) - X.

    4. Speci f width of box or [Cube] : ( - []:) .

    740 IV.

  • Cube, , , .

    5. Speci fy h e i g h t of box: ( :) - Z.

    6. Specify r o t a t i o n angle of box about the Za x i s or [Reference] : ( Z []:) - . XY. , , , - , 0. Reference (), - Reference ROTATE ().

    , .

    . 23.16 {Wedge). ,

    AI_WEDGE - , ; - Cube. .

    . 23.16. HIDE

    .

    1. Wedge () Surfaces.

    ^ 2. Speci f c o r n e r p o i n t of wedge: ( :) .

    3. Speci f l e n g t h of wedge : ( :) - X.

    4. Speci fy width of wedge: ( :) Y.

    5. Speci fy h e i g h t of wedge: ( :) Z.

    23. 741

  • 6. Specify r o t a t i o n a n g l e of wedge about t h e Za x i s : ( Z:) . XY. , , - , - , 0.

    AI_PYRAMID

    . - , . . . . 23.17 , .

    . 23.17. , AI_PYRAMID

    .

    1. Pyramid () Surfaces.

    2. Specify f i r s t corner p o i n t for base of pyramid:( 1- :) . .

    3. S p e c i f y second c o r n e r p o i n t f o r base ofp y r a m i d : ( 2- :) - .

    4. Specify t h i r d corner po int for base of pyramid:( 3- :) .

    5. Specify f o u r t h c o r n e r p o i n t for base ofpyramid or [Tet rahedron] : ( 4- []:) T e t r a h e d r o n , .

    6. Tetrahedron, Specify apexp o i n t of t e t r a h e d r o n or [Top] : ( []:), ( ) -

    742 IV.

  • . .

    7. , Specif apex p o i n tof pyramid or [Ridge/Top] : ( [/]:). ( ), Ridge () (). Ridge, . , .

    . , - . , . , . - , LINE (). Specify f i r s t p o i n t : ( :) , . , - . , - . - . , , , @0,0,2. , "", .

    AI__CONE .

    . 23.18 - HIDE ().

    7

    ), .

    8. View Top View ( ) .

    9. View () SE Isometric View( ).

    10. ViewOHide (^); HIDE (), .

    11. . , . 23.28.

    . 23.28.

    AutoCAD (extrude)

    . , TABSURF (-), , , AutoCAD (pathcurve), , . . - . . 23.29 .

    () , . - TABSURF, , XY, . - TABSURF .

    , , . , - .

    754 IV.

  • . 23.29. , TABSURF

    SURFTAB1 , - . , , .

    !

    . 23.29. - . - , . , -

    "*"""~ , . -. , - . , -, , . T A B S U R F .

    TABSURF , .

    - .

    1. , . -, , , , . - .

    2. ( ). - , , .

    3. Tabulated Surface ( ) Surfaces ().

    4. S e l e c t o b j e c t for p a t h c u r v e : ( - :) , .

    5. S e l e c t o b j e c t f o r d i r e c t i o n v e c t o r :( :) , - .

    23. 755

  • ab23~e.dwg, - Drawings -.

    . 1. ab23-e . dwg -.

    2. ab2 3-5 .dwg AutoCAD Bible. - Z=30. 30. - . : ( OSNAP ). - Endpoint Midpoint. - Const. . 23.30.

    . 23.30.

    3. CIRCLE (). - :Specify c e n t e r po int for c i r c l e or [3P/2P/Ttr (tan tan r a d i u s ) ] : From_from Base p o i n t : 1 . 23.30: @-l,3^Specify r a d i u s of c i r c l e o r . [ D i a m e t e r ] : .75

  • . ( , , .) .

    6. MIRROR (). , . - .

    7. MIRROR, . - .

    8. ZOOM E x t e n t s ( ), .

    9. . , . 23.31.

    : ( [ / / / Y/ Z] :) .

    4. , Specify the secondp o i n t on the r o t a t i o n a x i s : .

    5. Specify r o t a t i o n ang le or [Reference] :( []:) - Reference ().

    6. , Exit .

    AutoCAD . , AutoCAD - Modeling Operat ion E r r o r : ( :).

    SOLIDEDIT (

    ), ( ). - , . - , .. , . - , , . AutoCAD . . - " " , . " ". , 24.42 15, , . - .

    24. ... 807

  • --X. 24.42. - 15

    , . , , AutoCAD .

    ! Taper Faces ( ) Solids Editing.

    2. , . - .

    3. Speci fy t h e base p o i n t : ( :) , - . .

    4. S p e c i f y a n o t h e r p o i n t a l o n g t h e a x i s oft a p e r i n g : ( :) -, . - .

    5. Speci fy t h e t a p e r a n g l e : ( :) -90 +90.

    808 IV.

  • 6. , Exit .

    AutoCAD . , Modeling Opera t ion E r r o r : ( :).

    , . AutoCAD (-

    region) . EXTRUDE (). , , , .

    1. Copy Faces ( ) Solids Editing.2. , . -

    .

    3. Specify a base p o i n t or d i s p l a c e m e n t :( :) , .

    4. Specify a second p o i n t of d i s p l a c e m e n t :( :) , . .

    5. , Exit .

    AutoCAD .

    . ,

    , . , , , .

    ^00^ , - , , .

    . - , . , , . - 25, " - ".

    .

    ! 1. Color Faces ( ) Solids Editing.

    ~ 2. , . .

    3. AutoCAD Select Color ( ). .

    4. , Exit .

    AutoCAD () .

    24. ... 809

  • ab24-l l .dwg, - Results -.

    . 1. 2 4 - 1 1 . dwg, -

    R e s u l t s .

    2. ab24-13.dwg AutoCAD Bible. -, . 24.43. , 0,0,0.

    . 24.43.

    Solids Editing ( ) -, - - .

    (, -, OSNAP ). Midpoint.

    Offset Faces ( ) Solids Editing.

    S e l e c t f aces or [Undo/Remove] : ( [/]:) . , , . , - , . Remove () . . , - Add (). , -, Enter .

    Specify t h e o f f s e t d i s t a n c e : ( :) .1

  • 10. Specify a n o t h e r p o i n t a long t h e a x i s oft a p e r i n g : ( :) 2.

    11. Specify t h e t a p e r a n g l e : ( -:) 10

  • 3. Specify a base p o i n t or d i s p l a c e m e n t : (- :) . .

    4. Specify a second p o i n t of d i s p l a c e m e n t : (- :) , - . .

    5. , Exit .

    AutoCAD ( ).

    . -

    . , , , .

    | | gp 1. Color Edges ( ) Solids Editing.

    ^^ 2. , . .

    3. AutoCAD Select Color ( ). .

    4. Exit - .

    AutoCAD () .

    SOLIDEDIT ( )

    . , , , . .

    () AutoCAD,

    , (), - , , , , . , ( ), - - . , , -, . . 24.45 , .

    .

    1. , . - 1" , -. , - , , , .

    $" 2. Imprint () Solids Editing.

    - 3. S e l e c t a 3D s o l i d : ( :) , .

    812 IV.

  • . 24.45. . ,

    4. S e l e c t an o b j e c t to i m p r i n t : ( , :) (), - .

    5. D e l e t e t h e source o b j e c t : ( - :)

  • (). S e p a r a t e SOLIDEDIT . - , - 18, " ".

    plijT;; Separate () Solids Editing. -- S e l e c t a 3D s o l i d : ( :) -, . AutoCAD -.

    AutoCAD , . AutoCAD - The s e l e c t e d s o l i d does not have m u l t i p l e lumps( ).

    , , ( -

    ). S h e l l SOLIDEDIT. - . .

    - 1. Shell () Solids Editing.

    2. -.

    3. Remove f a c e s or [Undo/Add/ALL] : ( [//]:) , - . , - , , , (, , ). , .( 1 face found,1 removed (1 , 1 ), , AutoCAD , , ).

    4. E n t e r t h e s h e l l o f f s e t d i s t a n c e : ( - .) . - " ", - .

    5. Exit - .

    AutoCAD .

    - . - -

    ACIS. - AutoLISP- VB -. , - , , -. .

    814 IV.

  • Check () Solids Editing, S e l e c t a 3D s o l i d : , - . , AutoCAD Thiso b j e c t is a v a l i d ACIS s o l i d ( - ACIS).

    ab24-j .dwg, - Drawings -.

    . 1. ab24-j .dwg, -.

    2. ab24-13 .dwg AutoCAD Bible. , .

    3. Imprint () Solids Editing. :Select a 3D sol id: Select an object to imprint: Delete the source object : y

  • SECTION () - UCS O b j e c t (IICK ), . MASSPROP .

    1. . . 24.46 MASSPROP .

    jBAutuCAD Text Window Di

  • . , - .

    SOLIDEDIT , -. , - AutoCAD - .

    AutoCAD - MASSPROP ().

    .

    24. ... 817

  • , -.-..-?-.* ".* *-^*""*'^ U U , - ,< *~w"/.' , , .. -

    '1 * V ." ^? *"l!B&l& -. . 22," ", - . , - .

    AutoCAD , - - {mapping) -

    " # . =.. --.-: -" . . 25.1 , AutoCAD.

    (rendering)

    -. 14, AutoCAD , AutoVision.

  • , , . Auto-CAD (Render), - (Photo Real) (Photo Raytrace).

    . 25.1.

    Render (). - AutoCAD. - , .

    Photo Real (). . , , - .

    Photo Raytrace ( ). , - , ,

    ,

    . .

    1. , . , , .

    2. . AutoCAD : - (ambient), (distant), (point) (spotlight). .

    3. . .

    4. . . , () , , -, , , . - , .

    25. ... 819

  • 5. . , .

    6. ( ).

    7. , .

    8. .

    . , - . , - , () , .

    .

    , , . Render(), . - Render () , - . . 25.2 - Render ().

    Scenes Mapping Landscape Edit

    Hide Render Preferences

    -Statistics

    Render Lights

    Materials Library

    Landscape Library

    Landscape New

    Background

    . 25.2. Render

    E S S Render () Render (). Render (), . 25.3.

    , - .

    . - Rendering Procedure ( ) Render.

    Query for Selection ( ), AutoCAD - S e l e c t o b j e c t s : ( :) .

    Crop Window ( ), AutoCAD .

    Rendering Options ( ) RenderCache (), , . AutoCAD - , , -, , .

    820 IV.

  • fi/c. 25.3. Render

    Render (), .

    ab25-a.dwg, - Drawings -.

    . 1. ab2 5-a.dwg -.

    2. ab25-2 . dwg AutoCAD Bible . - Render () , - .

    3. Render () Render (). Rendering Procedure ( )

    Crop Window ( ). Rendering Options( ) Render Cache (),

    4. Render ().

    5. Pick c r o p window to r e n d e r : ( :) . , AutoCAD .

    6. . , . 25.4. , , , - , .

    AutoCAD -

    , ,

    25. ...821

  • . AutoCAD , . .

    . 25.4. -

    Lights ( ) - Render (). Lights ( ), . 25.5.

    Puc. 25.5. Lights

    . -

    , . . , (, ), - . , . . , . . .

    RGB (Red-Green-Blue) HLS(hue, lightness, saturation , , ). -

    822 IV.

  • , , - () ().

    .

    RGB. RGB - . . 1, ( ).

    Windows. Select Custom Color ( ), - Color () Windows, RGB, HLS. HLS - , . , - , - .

    ACI. Select from ACI ( ), AutoCAD Color Index system ( AutoCAD). AutoCAD Select Color ( ), .

    . , -

    .

    (

    ) , AutoCAD Sun AngleCalculator ( ). North Location ( ) Lights. - . , Angle() . Y - 0, X 90 .

    , . Y . .

    (ambient light) .

    . . 0.30. Intensity () . "" . .

    25. ... 823

  • .

    . - , .. .

    , Point Light () - , New (). New (), New Point Light ( - ), . 25.6.

    " \*

    V'uto."-' . % . .-;-"' i. .*'s-*iocn . :".J"

    ""I .*J UiJ

    Puc. 25.6. New Point Light

    Light Name ( ) .

    , , - . . ,

    1, 2. P-overhead (-), P-door (-) ..

    Attenuation () , -

    . ipn .

    None (). .

    Inverse Linear ( ). : 2- -, 4- . .

    Inverse Square ( ). : 2- - 4 , 4- 16 . , .

    824 IV.

  • , , Intensity

    (), . , .

    , , -, .

    , , , - .

    None (), , - , 1.

    , 0.

    .

    , -

    . X, Y , , Z - . , ! - - .

    AutoCAD . - ,

    ! .

    Show (), -. Modify (), .

    , - . , . , Node ().

    . .

    -

    . Shadows On (), . Shadow Options ( ) ; . .

    , .

    25. ... 825

  • (spotlight) , -

    . , . , - , hot spot ( ). , - . . 25.7 , , .

    . 25.7.

    , Spotlight () New () Lights ( ). New, New Spotlight ( -), . 25.8.

    fc..',. 45004 1 iiL "\i'^^

    3

    Puc. 25.8. New Spotlight

    826 IV.

  • Light Name ( ) . , , . -

    . , SI, S2, - S-overhead (S-), S-door (S-) ..

    ( Hotspot) -

    ( Falloff). -, . - 160. - , . - 44, 45. - . , .

    , .

    . , , -, . , , .

    .

    , . , .

    , Distant Light () New () Lights( ). New; New DistantLight ( ), . 25.9.

    New Distant L in lit

    *?

  • Light Name ( ) . -

    , , . - .

    , , Intensity (),

    . .

    , . , -

    , .

    , . -

    , . .

    (azimuth) XY;

    , 0. , . -180 180 ( -180 180 ). (altitude) XY. 0 90, -90 90. ( - -90 , .)

    Modify (), .

    , . - .

    Sun Angle Calculator ( )

    Sun Angle Calculator ( ), . 25.10.

    Sun Annie Calculator

    Bate

    Latitude

    _J "

    TI -^; zlCF V^** ...

    . 25.10. Sun Angle Calculator

    828 IV.

  • - . . - . - .

    , . , .

    1. .

    2. 24- .

    3. . DaylightSavings ( ), .

    4. . 0 () 90 ( ). 0 (, ) 180 ( ).

    5. (North) (South) (East) (West).

    6. , Geographic Location( ); Geographic Location( ), . 25.11.

    IGeiHitaiiliic Location

    : latitude | ^ | < . \ ( ^ *... ;

    i li ] l u*- 1'"^ H i i **v._._^"/?^ _7 J ! * . T J I

    I OK I ! I , v-.ev . ..j.^ . .

    . 25.11. Geographic Location

    7. . . ( .)

    8. Nearest Big City ( ), - . - . Nearest Big City ( ), - . City(), .

    9. .

    10. Sun Angle Calculator ( ) , New Distant Light.

    25. ...829

  • , - . , .

    . .

    Shadows On (), .

    Shadow Options ( ) -, . .

    , , - Lights ( ).

    ( ) -

    . - .

    , , - Render (). -

    , .

    AutoCAD . . 25.1 -

    .

    25.1.

    Volumetric()

    Maps ()

    Raytraced{)

    Photo Real() Photo Raytrace( )

    Photo Real() Photo Raytrace( )

    Photo Raytrace( )

    , - , -

    -

    , -, -

    , , - -

    , ,

    , .

    830 IV.

  • , -

    . Shadows On() . , Shadows ( ) Rendering Options ( ) Render (). Shadows Photo Real () Photo Raytrace ( ).

    . - Shadow Options ( ), Shadow Op-tions ( ), . 25.12.

    Photo Real Photo Ray-trace Shadow Volumes/RaytraceShadows ( / ). , .

    Shadow Volumes/Raytrace Shad-ows , , .

    , , 64 4 096 . , - .

    (Shadow Softness) 1 10 . - , - . 2 4.

    Shadow Bounding Objects ( -), , .

    ab25-a.dwg, - Drawings -.

    , 25.12. ShadowOptions

    . 1. ab25-a.dwg -.

    .

    2. ab25-3 .dwg AutoCAD Bible. - Render () , - .

    . Lights ( ) Render(). Point Light () New (). New, New Point Light( ).

    4. 1 Light Name ( ). Modify (). . Pan Real-time ( ) , , . 25.13. ,

    25. ...831

  • . E n t e r l i g h t l o c a t i o n< c u r r e n t > : ( :) , . 25.13. New Point Light( ).

    . 25.13.

    5. 250. Color () Select Custom Color ( ) - . . , RGB .

    6. Shadow On (). , - Lights ( ).

    7. Spotlight () New (). S1 Light Name ( ), Mod-ify (). Enter l i g h t t a r g e t < c u r r e n t > :( :) - . Enter l i g h t l o c a t i o n < c u r r e n t > :( :) @0,0,5'^, - , , .

    8. Falloff ( ) 55.00 Shadow On (). , Lights ( ).

    9. Distant Light () New. D1 Light Name ( ) - Shadow On ().

    10. Sun Angle Calculator ( ). 9/1 8:00 . ( .) CST. - Daylight Savings ( ). 41.00 91.57. - North West. Geographic Location

    832 IV.

  • ( ), , . ( , .) , Lights ( ).

    11. Lights ( ) North location( ). 90 . , .

    12. Named Views ( ) View(). Render! Set Current ( ), .

    13. Render () Render(). Light Icon Scale ( -) 24, . ( .) Rendering Type ( ) Photo Real (-). Render (). . , . 25.14. , , . , .

    . 25.14. ,

    14. Render (). Shadows() Rendering Options ( ). Render (). , . ! ! , . , - . , . 25.15.

    15. . -, .

    25. ... 833

  • . 25.15. ,

    . ,

    : , , . , .

    ,;> , Scenes () Renderi: (). Scenes (), . 25.16.

    . , .

    , .

    1. New () New S c e n e( ), . 25.17. New Scene .

    2. Scene Name ( ).

    . 25.16. Scenes

    ALLAPDWIEWRENDER1

    : 25.17. New Scene

    834 IV.

  • 3. . .

    4. . , . , . "ALL" (*BCE*) .

    5. .

    Scenes . , - . - Render ().

    . ' i l f i t ab25-2.dwg, - Results -.

    . 1. a b 2 5 - 2 . dwg , .

    AutoCAD B i b l e R e s u l t s , -.

    2. a b 2 5 - 3 .dwg AutoCAD B i b l e . - Render () , - .

    -"-: 3. S c e n e s () Render ().i New () S c e n e s ()

    New S c e n e ( ).

    4. morning Scene Name ( ).

    5. RENDER1 Views ().

    6. D1 1 Lights (), .

    7. , .

    8. . -, .

    :

    . -, . -. , , , - . .

    ^ AutoCAD . ~ . , Materials Li-brary ( ) Render (). - Materials Library ( ), . 25.18.

    25. ... 835

  • Materials Libraryjjjnent Drawing -

    GLOBAL'

    j1

    1i

    " * r " j revew | ! ,

    i (-4-v ' - 1

    3DCELTEXMAP4W4V BAR PATTERN ZAMOEBO PATTERNAPEAPE BUMPAQUA GLAZEBEIGE MATTEBEIGE PATTERNBEIGE PLASTICPLACI, MATTEELACI. PLASTICBLUE CLASS

    j ! - I

    . 25.18. Materials Library

    . m l i . -

    , , r e n d e r . m l i . - Materials Library ( ) , - . , AutoCAD.

    Current Drawing ( ) .

    Save As ( ) - .mli-.

    Purge (), -, .

    Current Library ( ) .

    , , Save. . ml i-, .

    .mli- ( ), Save As.

    , Open(), .

    (), .

    1. .

    2. Import ().

    3. Materials List ().

    4. Preview () Cube () Sphere (), , , .

    5. Preview (), .

    836 IV.

  • 6. . 1-5, .

    7. .

    , , - . -

    .

    : - , . , , , - .

    , Delete(). Export (), , - , . -, Materials Library( ) , . , .

    ab25-3.dwg, - Results -.

    . 1. ab2 5-3 .dwg , .

    AutoCAD B i b l e R e s u l t s , -.

    2. a b 2 5 - 4 . dwg AutoCAD B i b l e . - Render () , - .

  • Matcntfe"GLOBAL"BEIGE PLASTICGREEN GLASSLIGHT WOOD TILEPINS MARBLESTITCHED PATTERfWHITE MATTEWOOD-MED ASHWOOD -WHITE ASH freview

    I Sphere

    Select Detaiis (^).

    , AutoCAD . , . , , -. , AutoCAD Windows ( , : \windows\temp). , .

    1. AutoCAD ToolsOQptions ( "^) - Files ().

    2. "+", Temporary Drawing F i l e Locat ion ( ), (. 26.13).

    3. Temporary Drawing F i l e L o c a t i o n , - Browse ().

    876 V.

  • {g Wortmg Support File Search Palh^ Device Dnvei Fie Search Palh PioieclFdesSearchPath

    [_] Menu, Help and MiscelaneousPileNames

    U TetfEditof Dictionary and Fonl Fib Names

    0 P"WFile Spooler and Prolog Section Names

    U Pcnter Suppo" File Path

    ( ^ Seerrh Palh lor 0 tire 1 Applications

    ^ i Automatic Save File Location

    ^ Dala Sources Location

    ] Drawing TernplateFileLocation

    Lng File Location

    2***,.,

    '.%'*. .'

    Tempoiarii Eternal ReterenceFileLocetio-SpecKjiIhepeS'fa(^**enBjmi1^Widow Xt-,, '

    Pwc. 26.13. Files Options

    4. Browse for Folder ( ) , - .

    5. , Options.

    AutoCAD,

    - . AutoCAD , - . .

    , AutoCAD, AUDIT () RECOVER (BOCCTAH). - . , , .

    , AutoCAD , .

    1. File^Drawing Utilities^Audit (^ 1^).

    2. F i x any e r r o r s d e t e c t e d ? ( ?)

  • 2. File^Drawing Utilities^Recover (^ 1^).

    3. Recover Drawing File ( ) - . AutoCAD - ; .

    , "" . (DarrenYoung) f h t t p : //www.mcwi . com).

    Insert^Block (). Browse () - . ( 18, " ".) - AUDIT.

    Insert^Extemal Reference ( 1^ ). . ( 19, " ".) AUDIT.

    , , , , . - , , , - - , . - AUDIT.

    , , .

    File^Save As (=> ) ( ).

    WBLOCK.

    . DXF-. ( . DXF - 27 " ".)

    FileoSave As .DXF-, AutoCAD.

    , - , IntelCAD h t t p : / / w w w . i n t e l c a d . c o m .

    , ,

    , , . , Auto-CAD ( , .bak). - . dwg . . ,$. . dwg. , -, , .

    , - . Too Is "^Options

    878 V.

  • General (). Maintain a log file ( ). - , , , , . , -. Files () Options.

    , ScanDisk. StartoPrograms^AccessoriesoSystem Tools^ScanDisk (^^^ ScanDisk). , , .

    . - , , - . (.. - ). , Star t^Programs^Accessor ies^Sys tern Tools'^Disk Defragmenter.

    , AutoCAD

    AutoCAD 2002 , AutoCAD 2000. - AutoCAD , AutoCAD 2002. AutoCAD 2002 , .

    t***0* - AutoCAD 2000 , AutoCAD 2002,

    . , - AutoCAD 2000 Dimensioning Object Enabier. He - , AutoCAD 2000. Dimensioning Object Enabier - : h t t p : //autodesk.com/enablers.

    , AutoCAD 2002, 14 13. . DXF 12 ( - ). Fi le^Save As (^ ), - Save as type ( ). AutoCAD .

    AutoCAD DesignCenter;

    , , - . , AutoCAD . , AutoCAD.

    , AutoCAD .

    26. 879

  • ...

    , '--" \

    utoCAD . ,

    . - :

    , CAD-;

    ;

    AutoCAD ;

    AutoCAD;

    , , - .

    .

    AutoCAD , .

    , - .

    - . ( ) -, . A AutoCAD , .

    DXF-. AutoCAD - .

    , . , -, .

  • AutoCAD . - , "". , - AutoCAD. .

    . 27.1 , AutoCAD. -

    , , -, .

    27.1. ,

    WMF (Windows Metafile For- , Windowsmat)

    ACIS . - (ASCII) . s a t

    STL , -

    BMP , Windows

    EPS (Encapsulated PostScript) - .

    DXX Extract , . DXF,

    3DS 3D Studio Autodesk

    DXF (Drawing Interchange CAD, Format) CAD-. DXF-

    AutoCAD 2000, 14, 13 12.

    DXB , (.. ) , DXF

    XML D e s i g n X M L , , , -

    DWF (Drawing Web Format) Web-

    XML- DWF- .

    27. 881

  • DXF-

    100AcDbBlockEnd

    ENDS

    SECTION

    2ENTITIES

    GLINE-"

    54100JLcDbEntity

    100AcDbLine

    102.502406--

    204 . 5

    300.0

    117.551711-

    213.033333*-

    310.0

    X-

    Y

    X

    Y

    . 27.1 DXF-, . - , , . AutoCAD , -, . CAD-, DXF- -, CAD-.

    DXF, Fiie^Save As. DXF. - 12 14. , AutoCAD 2000 - DXF. , Save.

    . 27.1. DXF- CAD-

    (( and "" ;-"

    /*i/t:. 2A/. Create Transmittal - , . -

    , Password () - , . - .

    , , . , Browse () Location ().

    ( ), -

    ^ , windows\Temp, -" .

    Create Transmittal .

    Convert Drawing To ( ). , AutoCAD 2000 Release 14. .

    906 V.

  • Preserve Directory Structure ( ). - () - . , , -, , , . - Preserve Directory Structure ( ) -. , , .

    Remove Paths from Xrefs and Images ( -). , - , . , , Remove Paths from Xrefs and images, , - , - .

    Send E-mail with Transmittal ( ). , . , . - .

    Make Web Page Files ( Web-). Web-, . - Web- intranet Internet URL- Web-, . , Web-, , Web- : www.e l lenf i n k e l s t e i n . c o m / a b u p d a t e / a b 2 1 - 4 .htm.

    , AutoCAD , - Files (). , , a c a d . f mp ( , ), SHX- ( ), - , . AutoCAD 2002 eTransmit (. 26, " "). - -, . , , - , .

    , , Open ().

    , , , List View () Tree view ( ), .

    , Include Fonts( ), Cre-ate Transmittal. , AutoCAD, , , . TrueType , , , .

    Report (). Notes () ( General ()), . , - , SHX- . , Save As ( ).

    28. AutoCAD Internet 907

  • , . Send E-mailwith Transmittal ( ), AutoCAD , . , AutoCAD . Make Web Page Files( Web-), Web -, . , AutoCAD , .

    ^00^ - MeetNow. .

    AutoCAD2000i , MeetNow,

    AutoCAD NetMeeting Microsoft.

    , , MeetNow,

    ! "", "". .

    , , , MeetNow, . -, . , - Microsoft Paint ( - ), - .

    NetMeeting? NetMeeting (-1 ), . -, . - NetMeeting Standard () - AutoCAD. AutoCAD OnlineNetMetting ( ), , , - Find Someone ( ). - . 28.2. ( , .)

    MeetNow Autodesk , Find Someone - Autodesk ( ).

    , -

    , . , .

    908 V.

  • ['Find Someone

    Sriset a E)e none at idect from fat " . _.__' ,_ _~ / .

    $ 1 # 1 Lest Name |FName | E-malAddres* 1 tocSBon

    s$ FirieKtHn Ellen ellenlinkl@bigFoot com FanfiekJ.IA

    - " , ' - ' - - - ' - .

    C o n w t e t f s

    a u t h o i o t A u t o C A D 2 0 0 0 B i b l e

    5

    A/c. 25.2. Find Someone , . ( (Bill Plante), no AutoCAD AutoCAD LT, - .)

    !-| Find Someone ( ), " ^ 1 Help (), Refresh (). , ( - ), . , - Find Someone.

    _i_ - -

    . , , , -. , - , .

    , , , . ?( , Meet-Now, - .) , , " ". , - , . .

    1. Net-ft*^8 Meeting, -

    Windows.

    2. Open Net-Meeting ( NetMeeting). - NetMeeting, . 28.3.

    '4 3. End Call ( ).. 28J. NetMeeting

    .

    , . , .

    1. Find Someone ( ) -, . ( , - , Refresh , .)

    2. Call (), .

    28. AutoCAD Internet 909

  • 3. (, ) NetMeeting( ). - , - . . 28.3 - .

    4. Net-Meeting , . , Chat ( ) NetMeeting. Chat, - . 28.4, , . ( -, c o n n e c t w i t h 0 o t h e r s , ,, .)

    Chat - chattinq with 1 oiliei(s)Elen Fnkebtcinb you tooEkn Ftikefclen

    ti wi agsm'rfsiiFlsms[pika'pj.u fiui ' sol d romi"i.!tdjg"

    iv I e I

    i

    Send

    Evetyone In Chal

    Chat is active *'" '

    - - *

    -

    . 28.4. Chat -. ,

    - Message () . - . - , , . !

    NetMeeting , . -, , -, , .

    .- , , , AutoCAD -- . NetMeeting Share( ). , Share ( ) - ( ) AutoCAD 2002 Share ( ). -, AutoCAD, . 28.5. , , Share.

    AutoCAD. Allow Control ( ), Control () Share. . 28.6 , .

    , , .. , , - .

    , . Chat (. . 28.4), - , NetMeeting.

    910 V.

  • . 28.5. ( -), : ( -)

    ff William Planie's proqrams - controlled ly Lllen f-inkelstein

    . 28.6. - AutoCAD,

    28. AutoCAD Internet 911

  • , Message , , . Chat . , , Chat - .

    , " " Microsoft Paint, -

    , , . , , ( , ), .

    , Whiteboard ( -) NetMeeting. , . 28.7.IJUUntitleil - Whiteboard - tisinct whiteboard with 1 otliens)

    JWr,

    . 28.7.

    , , NetMeeting

    . :

    ."\ ! NetMeeting Transfer Files ( ).

    ^"^ 2. Add File ( ) , - .

    3. , . - , .

    4. Send All ( ). NetMeeting - .

    912 V.

  • NetMeeting NetMeeting , ,

    . , Find S o m e o n e - . .

    1. NetMeeting Tools^Options (^).

    2. General () Options ., Comments (), Comments Find Someone.

    3. Batdwidth Settings ( ) Internet. NetMeeting, .

    4. , Secu-rity ().

    5. Audio () , . Tuning Wizard ( ).

    6. , Video ().

    7. .

    , Options, NetMeeting. -, , NetMeeting Options. , , Tools^Options.

    Web, , Internet

    , ! - , ? AutoCAD 2002 .

    Browse the Web - Open; - , Web , Search the Web (i ^ Web) Select File ( ), - File^Open (1*). , Internet, AutoCAD Browse the Web Open ( Web ), - . 28.8. Open, "" Web, Internet.

    ^000i0i Microsoft Internet Explorer 4.0 , -

    Web.

    28. AutoCAD Internet 913

  • . 28.8. Browse the Web Open

    Look in ( ) Browse the Web Open - , Address () Web-. ( , Look in Web- Autodesk.) Web-, , , - . , , Web-, . , Web-, , File Name ( ), - . URL- -, , http://www.rainbow.com/ffa irport/hangar-a.dwg. ( , .)

    , Open (), AutoCAD - .

    . - , Web-.

    i-drop

    XML (. - 27, " "), Web-.

    914 V.

  • AutoCAD 2002 , i-drop, - , , -

    : - , Web- .!

    ! Web-, i-drop, l ; iL_ , . 28.9. , -, , . Web-, - .& ... i-drop, Web- "~^Autodesk : h t t p : / / w w w . a u t o d e s k . c o m . - i-drop Publish to Web ( Web), .

    . 28.9. Web i-drop

    ,

    Web, Internet, > . , .

    , , . , Web- Web- .

    . , -

    AutoCAD , .

    1. . .

    2. Insert Hyperlink ( insert^Hyperlink (^-)). AutoCAD InsertHyperlink ( ), . 28.10. ( - Insert Hyperlink, .)

    Inset Hyperlink AutoCAD -.:' ' . , Select File ( -

    -:" ' " ) Save As (), .!

    3. , .

    28. AutoCAD Internet 915

  • : Web-, .

    Existing File or Web Page ( Web-). - ( - , , intranet Internet) Web-. Recent Files ( - ), Browsed Pages ( Web-), In-serted Links ( ).

    View of This Drawing ( ). . ( ) .

    E-mail Address ( ). , - .

    }|Fnir>ser1 Hyperlink

    Browse Kan,

    .\ 16-. DWGH:B27-C.DWGE;\AutoCAD Bblelab27-4.dwg

    ';.-: Path: p.. * ' . *"* '. * -.;*-;- s

    IBM**facto* ',

    Subjects wfthhypertnls.

    . 28.10. Insert Hyperlink

    4. Web-, File(), Web Page (Web-), . , Tar-get ( ), Select Place in Document ( ) "+" ( ) . .

    5. Hyperlink description ( ) . , URL . , , Internet ,

    6. , Link to file or URL, Use relative path for hyperlink ( -). Internet - intranet. URL .

    7. . AutoCAD .

    916 V.

  • HYPERLINKBASE, AutoCAD 2000. - . Base () Insert Hyperlink.

    , , - , , Web- (. 28.11).

    . 28.11. , , - Web-

    , . , ,

    Internet. - Internet, AutoCAD , - (URL), Internet.

    , , , - . Hyperlink^Open ( ==> ) .

    Web (. 28.12) Web-, , ,

    Word, Excel .

    Go Back

    Browse the Web

    Stop Navigation

    Go Forward

    . 28.12. Web

    28. AutoCAD Internet 917

  • - -

    . , , InsertoHyperlink (1^ ). Insert^Edit Hyperlink - . AutoCAD Edit Hyperlink ( -). InsertHyperlink. .

    a b 2 8 - a . d w g , a b 2 8 - a . t x t a b 2 8 - b . d w f , D r a w i n g s --.

    . 1. 28- . dwg, -.

    2. ab28-l .dwg AutoCAD Bib le . - (. 28.13).

    . 28,13. , - (Robert Mack), DexterCompany, , .

    3. a b 2 8 - a . t x t ab2 8-b. dwf - AutoCAD B i b l e . ( Windows Explorer.)

    4. Insert^Hyperlink (^). - S e l e c t o b j e c t s : ( :) , - 1 2 . 28.13. AutoCAD Insert Hy-perlink ( ).

    5. Browse (). AutoCAD B i b l e a b 2 8 - a . t x t . Open, Edit Hyperlink.

    918 V.

  • 6. HYPERLINK. 3 4 a b 2 8 - b . d w f AutoCAD B i b l e . - .

    7. - .

    8. . - .

    Web-AutoCAD 2002 DWF (Drawing Web Format). DWF-

    Web-, Internet . , , . , DWF- Web-.

    AutoCAD 2000i , j * AutoCAD 2002 . Publish to Web

  • 2. Plot Device ( ) Plot Name ePIot plotter. - DWF ePlot.pc3.

    DWF eView (optimizesd for viewing) , - , - .

    DWF ePIot (optimixed for plottong) , - . - , , eView.

    3. Plot to File ( ) (). AutoCAD , "" ( ) . DWF.

    4. , .

    5. . AutoCAD DWF-.

    -, , , . - .

    ab28-l.dwg, - Results -.

    . DWF-1. ab2 8-l .dwg , -

    . , R e s u l t -- AutoCAD B i b l e .

    2. Plot () .

    3. Plot Device ( ) Plot Name DWF ePIot (optimized for viewing)..

    4. File Name ( ) 28-1.dwf, -model , .

    5. . AutoCAD DWF-. - , .

    DWF-

    -. , - . .

    1. Fite&Plotter Manager {^ ).2. Plotters () - -

    , . Add-a-Plotter ( ).

    3. Next ().

    920 V.

  • My Computers Next.

    Plotter Model { ) Manufacturers ()Autodesk ePIot (DWF), Models () DWF ePIot (optimizes for plotting) DWF ePIot (optimizes for viewing). Next .

    Plotter Name ( ) . Next.

    Edit Plotter Configuration( ) , .

    Custom Properties ( ), , Custom Properties, - .

    DWF Properties ( DWF-), , - , , . , , , , - DWG DWF. ( - , DWF- , -, , , DWF-.)

    DWI- Properties

    10. , Plotter Manager. Finish ().

    11. , Plotter Configuration Editor.

    Publish to Web Publish to Web ( Web) HTML-

    , DWF, JPEG PNG. - , . .

    ||g?7 , Web-, - , . Publish to Web ( Web) , - Publish to Web. .

    28. AutoCAD Internet 921

  • 1. , . Next ().

    2. Create Web Page ( Web-), . 28.14, Web-. (AutoCAD , Web-.) (...), , - . Web- - , . , , - Web-. Next.

    Publish to Wtl) - QtMte Well Pane

    /"uc. 25.74. Create Web Page - Web- , -

    3. Select Image Type ( ) - DWF, JPEG PNG. . JPEG PNG - Image size ( ). Next.

    4. Select Template ( ) , - Web-, Next. .

    Array of Thumbnails ( ). - . .

    Array plus Summary ( ). . , Summary () Draw-ing Properties ( ). , .( - , Filec>Drawing Properties ( ).)

    922 V.

  • List of Drawings ( ). , . , .

    List plus Summary ( ), , , Summary DrawingProperties. , . ( - , File^Drawing Properties.)

    5. Apply Theme ( ) , Web-. , , - . Next.

    6. Enable i-drop ( i-drop) , , - i-drop. , Web- .

    7. Select Drawings ( ), . 28.15, , Web-. , - Drawing (). , ( ), , - Web-. Add (). ( , (...), - Open (). Add ().) Lay-out (), - ( , - layouti), Model(). Next.

    . 28.15. Select Drawing :, Web-, -,

    28. AutoCAD Internet 923

  • 8. Generate Images ( ) - , , - . (, , - Web-.) Next , AutoCAD .

    9. Preview and Post ( Web) - Preview ( ), - Web-. AutoCAD Web-, , -. Web-, , . 28,16.

    3Web Publishing . Microsoft Internet Ex|jlureiFile d V>w FavorUw IooU 1

    - Stop * Befietf

    . 28.16. , Array of Thumbnails medium JPEG. - JPEG. , i-drop,

    10. Post ( Web-), Web-. AutoCAD Posting Web ( Web), Save As (). - Save In ( ) . - FTP-, FTP- FTP. ( - intranet, -, .)

    924 V.

  • FTP- , Web-. , . Save (). File Upload (), - _ 28.17. - . - -, ! Web-, - . 28.17.

    11. , acwebpubl i sh. htm. Web- , , www.e l lenf inke l s te in .com, , www.e l lenf inke l s te in .com/acwebpubl i sh .htm. - Web- , , URL- .

    , Web- , FTP- .

    Web- Web- , -

    . , Publish toWeb ( Web) Edit Exist-ing Web Page ( Web-). Next() , . - Next. , .

    Select Drawings ( ) Update(), , ( ) Web-. Remove (). , .

    , Move Up ( ) Move Down ( ) , . , , , Web-.

    , Web. ,

    Web-, Publish to Web JPEG PNG, - , . DWF, , - . Volo View Express, Volo View. - AutoCAD 2002. Web- Autodesk - h t t p : //www. autodesk.com/products/volo. ( Volo View Express WHIP!, DWF.)

    28. AutoCAD Internet 925

  • Volo View Volo View Express DWG- . ,

    AutoCAD, .

    Zoom

    LayerItemed VIewi\ .lyotit:CJeerScaleBlack I VWhJt*-ifif ': '

    Page Setup.

    Volo View Express, DWF-. , . 28.18.

    , DWF-.

    Pan () , . .

    Zoom () - -, . , , , .

    Layers () - .

    Named Views ( ) - .

    ClearScale () - .

    Black&White (-) -.

    Print () . _

    . 28.18. - Save Target As ( ) - Volo View Express

    . URL-, -

    , (. 28.19). Web, , . URL-, . .

    1-temet-, , Web-. , -, Internet. , - -, Internet- Volo View Express.

    \Results\ab28-l .dwf,\Drawings\ab28-a.txt \Drawings\ab28-b.dwf, -.

    cm+p

    UntoSave Target fi_

    . DWF-1. Internet-, Internet. (

    -.) - Internet .

    926 V.

  • . 28.19. , URL- DWF-

    2. , Web-, c:\AutoCAD Bible\ab28-l.dwf( , DWF-). Volo View Express DWF-, . 28.20.

    . 28.20. DWF- Volo View Express

    3. 1 (. . 28.20). , . 28.21. Excel, .( .) - Back (), DWF-.

    28. AutoCAD Internet 927

  • qrv1fiR2flR21It21421221422221

    TAG HO212019181716151*13121119976

    54321

    PART NO DESCRIPTION DUG S I Z E HADE/PUR9 5 3 8 - 1 7 1 - 0 B 28 6 6 S - B 2 3 - B 1 69 0 8 1 - 1 1 4 - 18 6 6 5 - 8 2 3 - 8 1 29 B 2 9 - B 7 2 - B B 19 B B 3 - 2 3 7 - B B 19 * 5 2 - 6 2 8 - 0 0 19 * 5 2 - 6 2 7 - 8 0 19 4 5 2 - 6 2 9 - 8 0 19 0 0 3 - 2 3 6 - B B 29 0 7 6 - 0 5 2 - B 0 29 8 B 3 - 2 3 2 - B 0 39-22-029BB3-236-BB39548-277-8019BB3-236-BBU9083-233- BB19548-278-B019452-646-8019003-242-6019803-232-801

    SPflCER-SUPPORT LKLDING ROD CHfiNNEL-MOTOR HTG ROD WELDING WIRE - . STAINLESSBRRCHET-TUBE flSSV DfINGLE REflR

    PLftTE-SUPPORT, SML ( U P R ) "T L f l T E - S U P P O R T , LRG ( U P R ) "T L f t T E - M T G , BFR HSG" DftNGLE-StlPPORT, UERT" COLLAR-SHAFT M"ANGLE-HORIZ, SUPPORT" 'ANGLE-HORIZ, M I D , & REAR"'ANGLE-SUPPORT,DIAGONAL""SUPPORT-PLATE, MTG (8RG H S G ) ""ANGLE-SUPPORT, SPREADER"ftHGLE MTG, RING ASSV" 8

    -SUPPORT-CORNER, FRONT*' 8"PLATE-BASE, SUPPORT" 'ANGLE-HORIZ, RH & L H " ' H N G L E - H D R I 2 , FRT"

    EflCHFTPH

    DDNMM '

    UNITS

    EfiCH

    EACHEfiCH

    EfiCHNEfiCH

    FT

    . 28.21.

    , -. ZOOM (). , - . Pan () . Zoom to Rectangle( ) -, . Fit toWindow ( ), . ( , - Print (), .)

    2 (. . 28.20). .

    Volo View Express.

    , Internet AutoCAD.

    , Web- DWF-. DWF- URL-, - . Internet AutoCAD.

    V. VI " " AutoCAD, . , 29, " ", , - .

    928 V.

  • AutoCAD

    , AutoCAD - ,

    , , , - . : ( 29) AutoCAD { 33), ( 30), ( 31), ( 32).

    ... ,

    29. *" *5

    s . .; v -

    30 * [ - . - '

    31.

    32.

    33.

  • v :4

    AutoCAD - . -

    , , - , -. , - AutoCAD. , .

    AutoCAD -

    . , - AutoCAD - - . - . 29.1. - .

    . 29.1 - a c a d . p g p , - - .

    Hutendd 1

    . 29.1. Acad.pgp AutoCAD

    ,3DQ,3F,, .ADC,.AL, ,ftR.

    -AR, ,- ,ATE,-,,.-.,,

    -.BR,,.-.

    ItjiSearob %|13DARRHV3D0RBIT3DFACE3DP0LVARCflDCEHTER-BREftALIGNAPPLOflDARRAYflRRHVfiTTDEFfiTTDEF-OTTEDITflTTEDITATTED1TBLOCKBLOCKBHATCHBOUHDARV"-BOUNDARY"BREAKCIRCLEPROPERTIES-CHfiHGEl

    3

  • = 2 9 . 1 . j .- . - ^ - : - - - ? " - j . . * > : * * ? -*

    * cus , . -, SPELL ()

    a c a d . pgp AutoCAD. -

    acad. mnu AutoCAD.

    a c a d 2 0 C 2 . c f g AutoCAD, . Options (), -

    a c a d . m n l AutoLISP, AutoCAD. .mni- , LISP-

    a c a d . mr s AutoCAD, - .mnu.

    acad. d e l (Dialog Control Language DCL) AutoCAD. AutoCAD. - DCL-, AutoLISP

    a c a d . l in AutoCAD. - (*. l i n ) acad. l i n

    a c a d . l s p AutoLISP AutoCAD. AutoLISP AutoLISP

    a c a d . min AutoCAD

    acad. p a t AutoCAD.

    a c a d . . - . - - . Batch Plotting Utility

    a c a d . f np AutoCAD. AutoCAD - , , ,

    a c a d . p s f PostScript AutoCAD. P S O U T () P S F I L L ()

    a c a d . s i b AutoCAD, . -

    * . s c r , . ,

    *. shp , . - , . - . shx-,

    acad. r x ARX-,

    mtextmap. i n i

    a c a d . u n t ,

    29. 931

  • AutoCAD,

    . (ASCII) . - , , - (.. ). - , Windows. , Notepad. WordPad, Windows. - Save as type ( ) Save As ( ): . : Save , .

    ,

    AutoCAD, . , , AutoCAD. .

    . , . - , , - .

    . . , "" .

    , - AutoCAD. , AutoCAD acad. mnu mymenu. mnu, , AutoCAD.

    , : -, . :

    acad.lin;

    acad.lsp;

    acad.mln

    acad.mnl;

    acad.mns;

    acad.mnu;

    acad.pat;

    acad.pgp.

    , - AutoCAD, : , , .. , AutoCAD .

    932 VI. AutoCAD

  • . , , - . AutoCAD , . - . - AutoCAD .

    , , -

    , . AutoCAD --($ .

    . , {-) . , - , . , - , . 29.2.

    ' 29.2. ,

    ARRAY

    ATTDEF

    ATTEDIT

    BLOCK

    BOUNDARY

    DDPTYPE

    DDVPOINT

    DSETTINGS

    EXPORT

    GROUP

    HATCHEDIT

    IMAGE

    INSERT

    LAYOUT

    LAYER

    LINETYPE

    MTEXT

    OSNAP

    PAN

    PARTIALOPEN

    -ARRAY

    -ATTDEF

    -ATTEDIT

    -ATTEXT

    -BHATCH

    -BLOCK

    -BOUNDARY

    PDMODE, PDSTYLE

    VPOINT

    ORTHO, SNAP, GRID, ISOPLANE, AUTOSNAP, SNAPTYPE

    DXFOUT, STLOUT, BMPOUT, PSOUT, ACISOUT, 3DSOUT, WMFOUT

    -GROUP

    -HATCHEDIT

    -IMAGE

    -INSERT

    -LAYOUT

    -LAYER

    -LINETYPEMTEXT, -MTEXT

    -MTEXT

    -OSNAP

    -PAN

    -PARTIALOPEN

    29. 933

  • . 29.2

    CHANGE, CHPROP, COLOR, -LAYER, - L I N E T Y P E , -LTSCALE,

    PLOT

    PLOTSTAMP

    PROPERTIES

    PURGE

    RENAME

    STYLE

    TOOLBAR

    UNITS

    VIEW

    WBLOCK

    XBIND

    XREF

    -PLOT

    -PLOTSTAMP

    CHANGE, CH

    CELTYPE,

    -PURGE

    -RENAME

    -STYLE

    -TOOLBAR

    -UNITS

    -VIEW

    -WBLOCK

    -XBIND

    -XREF

    , , DIMSTYLE, Dimension Style ( ). -DIMSTYLE 15, " ".

    FILEDIA , AutoCAD , SAVEAS , , , - . 1, AutoCAD - .

    AutoCAD 2000, : AUTOLISP/

    ObjectARX-, AutoCAD , . F I L E D I A 1. - 0, - , - .

    , -

    , . , . - , , , . , .

    "" , (;). AutoCAD . ( !) / //, - .

    , AutoCAD, .

    934 VI. AutoCAD

  • a c a d . p g p Windows- -

    AutoCAD. , DOS.

    , .

    ^ AutoCAD. 33," ". , acad.pgp .

    Windows- acad . pgp Windows-

    :

    EXPLORER, START EXPLORER, 1,,NOTEPAD, START NOTEPAD, 1, *File to edit: ,PBRUSH, START PBRUSH, 1,,

    , Auto-CAD. , "" AutoCAD Windows. (1) , AutoCAD , , . AutoCAD . 1 . , Notepad * F i l e to e d i t : (* :). , AutoCAD. , , Windows Notepad. ( - .) Notepad, , - * F i l e to e d i t : .

    a c a d . p g p Auto-

    CAD. . , , , . a c a d . p g p , , , AutoLISP.

    :

    , *

    , . 29.1. , .

    acad.pgp , .

    , . , . .pgp- - .

    29. 935

  • , . ,

    ! .

    . acad.pgp1. AutoCAD.

    2. . explorer^. Auto-CAD Windows Explorer () - acad .pgp.

    3. Acad2000 ( "+", ). Support . acad.pgp, . Windows a c a d . p g p . , acad. I in, a c a d . l s p ,acad.mln, acad.mnl, acad.mnu a c a d . p a t . : " AutoCAD ".

    4. Explorer , acad.pgp. Windows Notepad. Windows Open With ( ), - Notepad, , Always use thisprogram to open this file ( ), . Windows - a c a d . pgp Notepad.

    5. , Windows (. 29.2). PRBRUSH .

    ; Examples; See alsoEXPLORER,NOTEPAD.PBRUSH,

    oF external connands forthe (SIflRTflPP)START EXPLORER,STAR! NOTEPAD,START PBRUSH,

    flUtoLISP

    1..1,Fiie1..

    Windowsfunction for an alternative Method.

    to edit: ,

    . 29.2. Windows acad.pgp

    6. . ( - , .)WORDPAD, START WORDPAD, 1,,

    7. acad.pgp. AutoCAD, .

    8. :, *PROPERTIES-, *CHANGE

    9. CHANGE () , " " . , , (=), =1. , eg ( ).

    936 VI. AutoCAD

  • .,-,CG,,

    CIRCLEPROPERTIESCHANGECHflNGECHfiHFER

    . 29.3. - acad.pgp

    . 29.4. Re-initialization

    10. -, , (, - ). *CHANGE (*) . . (He - , a c a d . pgp.)

    CG, *CHANGE

    11. FileOSave (^). a c a d . pgp, -, , . 29,3.

    12. Notepad. AutoCAD a c a d . p g p . - , -

    Notepad. Auto-CAD a c a d . p g p . - , REINIT (). reinit

  • Toolbars Toolbars () Customize (. 29.5) -

    .

    ' Customize

    '' jProperty| Keybowdj

    InquiryInieit

    Layouts-Modify

    Modify II/ Ob|ect Properties

    Obpct SnepRefet*fleletenceRendnShadeSofcft

    ] .,

    "ool p*

    /'. 29.5. Toolbars

    - Toolbars. . Toolbars. , . - : . - . - , Viewpoints () Zoom (), .

    , . , . , - Menu Group ( ).

    , Toolbars -

    New (). New Toolbar ( ), . 29.6. - ( , ), - . - Toolbars () Toolbars. , - (. 29.7).

    " ".^ - .

    /'MC. 29. . New Toolbar

    938 VI. AutoCAD

  • Carman* *odbart jftMteij taybovti)

    . 29.7. , Toolbers

    - , , -, , -, " ". , - .

    , ( , -

    Toolbars) , - . .

    1. .

    2. View^Toolbars (^ ), - Customize (). , , .

    3. , - .

    , Customize . , -, , - , . - - Customize, , -, .

    , (

    ?)- .

    Commands Customize. - Commands Customize . ( 13). Categories

    29. 939

  • () All Commands ( ) Commands, , . , . , .

    . Customize, . , .

    . (.. ), , - . - .

    . -

    .

    1. Commands Customize Categories() User Defined ( ). Commands : User Defined Button ( ) User Defined Flyout ( ).

    2. .

    3. Properties () Customize , Button Properties ( ) Customize, . 29.8.

    u n r a t e d v*i tha bUKMl

    "C"C

    . 29.8. Button Properties Customize

    4. -. -, .

    5. Help () . , .

    940 VI. AutoCAD

  • 6. . , Macro () AutoCAD . , . Macro , - , AutoLISP.

    . - 33, " ".

    7. Button Icon () Edit (), ( ).

    8. Apply (), ButtonProperties. .

    AutoCAD . , .

    Button Editor Button Editor ( ), . 29.9,

    . ( - ) ( , , , ).

    . 29.9. Button Editor

    . . Grid (), -. , , - .

    Pencil () . "" .

    Line () () .

    29. 941

  • Circle () . , , , - , . , - .

    Erase () . , , .

    Button Editor.

    Clear (), .

    Open () -. . bmp-.

    Undo (), .

    Save (), . bmp-. , ICON. bmp;

    Save as (), . bmp- .

    Close (), Button Editor.

    (). -, Customize, Commands Custom Flyouts ( ). .

    , , - , . - .

    1. Commands Customize.

    2. Categories () User De-fined ( ) User Defined Flyout . .

    3. Properties () Customize , Flyout Properties( ), . 29.10.

    4. , .

    5. , -. , .

    6. Apply (), Close ().

    7. . , .

    942 VI. AutoCAD

  • 0

    4od.yiOwe S-acReletenceRenfleiShadsSolidSolids EditingSlandard *Sulaeet

    " " ' "Ji ' **.|i "" *! i *S

    ACAD

    ACACACACACACACADACACACADACACACADACAOACADACAD

    J

    - 4 " -

    . 29.10. Flyout Properties - Customize

    . - , .

    . 1. Windows Explorer ()

    acad.mnu, acad.mnc acad.mns Acad2000\support . .

    2. Start from Scratch. ab29-l .dwg AutoCAD Bible.

    3. View^ Tool bars Customize. Zoom () . , Customize.

    4. Zoom Zoom Center () Zoom All() ( , , ). (Zoom Extents ()) - . Zoom Extents - , - .

    5. - . (, , . , , - .)

    6. Toolbars Customize New (). New Toolbar ( ) Name ( ) Special . .

    7. Commands. Categories Draw(). Donut () . I- .

    29. 943

  • 8. Modify () Edit Polyline( ). .

    9. View () Hid-den ().

    10. User Defined ( ) User Defined Button (, ). , Button Prop-erties ( ).

    11. , . 29.11. - ( - ):p e d i t \w .1

    1 Customize

    Emmrxk] Toobm BoKonF 'v,? . . 7

  • . 29.12.

    15. Zoom.( , .)

    16. Draw () Polyline() . - Plines .1 wide ( 0.1). - S e l e c t p o l y l i n e : . AutoCAD , 0.1. ( , . Plines .1 wide, Button Properties Customize,)

    17. .

    AutoCAD, acad.mnu, ! , , 33, " ", - AutoCAD.

    !

    p e d i t :

    p e d i t \w .1 ;

    1. p e d i t PEDIT (). p e d i t - . PEDIT - S e l e c t p o l y l i n e : ( :).

    2. (\) , , . , Enter an o p t i o n [Close/Join/Width/Edi t ver tex/Fit/Spl ine/Decurve/Ltype gen/Undo] : ( [////// .//]:).

    3. w Width (). - . PEDIT Speci-fy new width for a l l segments : ( :).

    4. , 0.1. . PEDIT Enter an opt ion [Close/Join/Width/Edit v e r t e x / F i t / S p l i n e /Decurve/Ltype gen/Undo]:.

    5. (;) .

    29. 945

  • , acad.mnu. , , . ; acad.mnu, acad.mnc acad.mns Acad2000\support. , .

    1. Tools Customize Menus (^^). Menu Customization ( ). Menu Groups ( ). Menu Groups - ACAD, .

    2. Replace All ( ), AutoCAD . File Name () acad.mnu Load (). acad. mnu, AutoCAD , . , Yes ().

    , Loading of a template menu file (MNU file) overwrite and :-*. J,,,> redeflnea to menu Hie (HNS MB), vrtilch resultt in e

    / ; ; Omtinue loading MHU file?

    3. AutoCAD : Menu l o a d e d s u c c e s s f u l l y .MENUGROUP:ACAD ( ). Close. - .

    33, " ".

    946 VI. AutoCAD

  • AutoCAD. ,

    acad.pgp; , - , .

    , .

    29. 947

  • !:;

    -

    - '

    " " f j r

    ,

    . - . - -, , -, -, .

    :

    -scr;

    (.. ASCII-);

    .

    14 , , - . 14, AutoCAD Batch Plot Utility, - - , .

  • , Notepad.

    . - , . , . , - . - , - . Notepad.

    , .

    , , , .

    , , - , FILEDIA 0. , . - , (, - layer) . .

    ^0^"** AutoCAD F I L E D I A , .

    , . - , .

    Notepad . -, AutoCAD ( ), - , , (), Notepad . , . , .

    . - . .

    : Notepad AutoCAD, Notepad . - F i l e to open: ( :) , . Windows a c a d . p g p . acad. pgp 29, " ".

    : , , . . -, , . . , , - , .

    , . scr. , , Notepad.

    30. - 949

  • , -. , , - , , .

    circle 2,2 1.5circle 6,2 1.5circle 10,2 1.5circle 14,2 1.5

    CIRCLE (), - . . 30.1.

    . 30.1.

    , .. AutoCAD,

    . , . , AutoCAD. , - . - , , :

    ( - , "" );

    - " ", , .

    , .

    1. ToolsORun Script (^). Select Script File ( ), . 30.2.

    2. .

    3. Open (). AutoCAD .

    AutoCAD AutoCAD, , -

    Windows AutoCAD, . - AutoCAD - Target (). AutoCAD Properties (). Shortcut (), . 30.3.

    950 VI. AutoCAD

  • /. JO. 2. Select Script File

    AutoCAD ?1 I'mncities

    Qmid SIMM I5 9 w-**

    ,,,

    .

    fwc. 303. Shortcut - AutoCAD 2002 Properties

    Target , Windows - AutoCAD. - . :

    : \J7yTb\acad. : \\__ / ___

    , , Target : \Program Files\AutoCAD 2002\acad.exe, ba-349.dwg c :\drawings p r e - p l o t . scr . Target :

    30. - 951

  • chpi'op-layerqsaueopen '

    -layerqsauecloseopen 'chprop-layerqsaue

    1 1 bylayee

    f n o - p l o t

    f : \ a e c \ f i p t 1B"a l l l i y l a y e r

    f n o - p l o t

    F:\aec\f lpt 1C"-

    a l l Delayer

    F n o - p l o t

    "C:\Program Files\AutoCAD 2002\acad.exe" c:\drawings\ba-349.dwg/b p r e - p l o t

    . s c r . , , Target, - , :

    "C:\Program Files\AutoCAD 2002\acad.exe" "c:\aec\drc\Dobbs FerryApartments .dwg" /b 1: \aec\drc\cleanup

    , AutoCAD, .

    , . AutoCAD :

    /t _6

    Tar-get, . AutoCAD , .

    , . - . . 30.4 m u l t i - c l e a n u p , s c r , Auto-

    -,/w - , , CAD. Target , AutoCAD -. 30.4. , , , on- Apt lA.dwg. , AutoCAD .

    SDI( single document interface ), 1. - , CLOSE, , . , - . - !

    , , - ,

    AutoCAD Today (AutoCAD ). - , - . AutoCAD Today STARTUPTODAY 0 - . S T A R T U P T O D A Y 1 .

    .

    1. CHPROP () , ByLayer .

    2. LAYER () ( - ), . , .

    3. .

    4. , .

    952 VI. AutoCAD

  • 5. , - . AutoCAD.

    , : - . ( ,

    ., , .)

    , . -, .

    - , . - .

    -a.dwg, Drawings -.

    . 1. -. dwg, -.

    2. ab30-l .dwg AutoCAD Bible .

    3. Notepad^. F i l e to open: ( :) , .

    4. , . , a l l . .Chprop a l l ci by layer

    -layer_f__no-plot

    qsave

    5. c l e a n u p , s c r AutoCAD Bible . Notepad. Bylayer , - . , - (, ). , .

    6. Tools^Run Script (1^).

    7. Select Script File ( ) c l e a n u p , scr , AutoCAD Bib le , Open. AutoCAD . - Bylayer, , , . , .

    8. , , . . - ( Starts Documents (1^ ), c l e a n u p , scr) . , - .

    9. .

    30. - 953

  • , 200 . - ? 200 , .

    , . , . -, , . - Microsoft Word. , , . , , . Microsoft Word Page Setup( ), [Landscape) - , . ( , , - .)

    . , - , . - .

    chprop all bylayer -layer f no-plotchprop all bylayer -layer f no-plotchprop all bylayer -layer f no-plot

    qsaue close open "f:\aec4qsaue close open "F:\aec\qsaue

    DOS. ( Starts Programs^MS DOS Prompt (=*1^ MS DOS).) DOS cd, , - . ( .) dir *.dwg /b>dwglst.txt . , - , dwglst. t x t . / , .

    , - . , , .

    , . , . Text Only ( ).

    chprop all bylayerchprop all c bylayerchprop all bylayer

    -layer f no-plot-layer f no-plot-layer f no-plot

    qsaue close open >-f:\aec\ fipt 1B"

    qsaue close open "F:\aec\ Apt 1"qsaue

    , , " ", .

    - -

    -.AutoCAD . .

    954 VI. AutoCAD

  • . t i f , .bmp . - ,

    -, Microsoft PowerPoint, Lotus Freelance Graphics ,"^ Corel Presentations. -, -

    , .. - 25, " ", 27, " ".

    , , .

    AutoCAD . , - . , .

    , .

    1. , .

    2. mslide^.

    3. Create Slide File ( ) , . . s ld .

    4. Save.

    , .

    1. vslide

  • 5. 3D Orbit . , . .

    6. MSLIDE. ab30-2b. sld.

    7. 3D Orbit . , - . .

    8. MSLIDE ab30-2c . s l d .

    9. Zoom Previous -, No p r e v i o u s view saved( ).

    10. vslide^. Select Slide File ( ) - a b 3 0 - 2 a . s l d . Open. AutoCAD .

    11. VSLIDE () ab30-2b. s ld . a b 3 0 - 2 c . s l d .

    12. Redraw All ( ), - .

    13. .

    -

    , -. AutoCAD , - .

    DELAY nnnn () , ( ). , DELAY3000 3 .

    RSCRIPT () . . - ( , ), .

    RESUME () , , .

    VSLIDE (), , . , , VSLIDE . ( ). , VSLIDE (*) . VSLIDE , . , :

    vslide ab30-2avslide *ab30-2bdelay 3000vslide

    956 VI. AutoCAD

  • vslide *ab30-2cdelay 3000vsliderscript

    .

    1. ab30-2a. s ld.

    2. ab30-2b. s ld .

    3. , ab30-2a. s ld.

    4. 0-2. s ld.

    5. ab30-2c . s ld .

    6. , ab30-2b. s ld.

    7. 30-2 . s ld .

    8. .

    -, .

    . -1. Notepad :

    vslide ab30-2avslide *30-2delay 3000vslidevslide *ab30-2cdelay 3000vsliderscript

    2. He . - ab30-2 . s c r AutoCAD Bible . Notepad.

    3. AutoCAD , AutoCAD Bib le . Tools^Options(1^ ) Files (). - Support File Search Path ( ), - Add (). Browse () - AutoCAD Bible . .

    4. AutoCAD Tools^Run Script (^). AutoCAD B i b l e ab30-2 . s c r Open.AutoCAD -. , - .

    5. - . - . , -.

    6. .

    - , .

    , , , -* - Display () Options

    (), , - . , , - , . ( 33, " ".)

    30 - 957

  • .

    . s i b . - , -. , , Draw^Surfaces^SD Surfaces (^^ ). - , .

    :

    library {slidename)

    , , , s d m o d e l . s l b . ( ):

    v s l i d e *3dmodel (ab30-2b)

    DOS.(, - .) AutoCAD SLIDELIB, - AutoCAD 2002\support .

    DOS, Start^Programs^MS-DOS Prompt. .

    1. (, Notepad), -. , - AutoCAD. .

    SLIDELIB "" , DOS d i r /, . -

    ^ "4^1 , d i r . ,

    a b 3 0 s l d . l s t , DOS - : d i r * . s l d /b > a b 3 0 s l d . l s t .

    2. , , .

    3. , , , ab30s ld . s i b . - DOS :"c:\program files\AutoCAD 2002\support\slidelib" ab30sld < ab30sld.lst

    "'*8' SLIDELIB , , -^ 0 ,

    .

    , .

    , , . - AutoCAD.

    958 VI. AutoCAD

  • , . , - , .. -. , .

    , .

    30. - 959

  • ...

    , AutoCAD - .

    . AutoCAD. , -, , -, , , , - , .. AutoCAD.

    .

    , . , , , / .

    a c a d . l i n . - . - . 11 . , acad . l i n , .

    ,

    , . - . . - :

    * [.]

  • .

    (*).

    47 .

    , .

    . , , . .

    .

    .

    .

    . - 80 .

    .

    :

    *seeingdouble. Hedge line, .25,-.1,-25,-.1,0,-.1,0,-.1

    , 0,25 , 0,1 (. 31.1).

    . 31.1. seeingdouble

    , , - LINETYPE () . -linetype

  • 7. Linetype ( ) Continuous (), Load () Load orReload Linetypes ( ).

    8. Load or Reload Linetypes File (). - Select Linetype File ( ) ab31- l . l i n , - AutoCAD Bible, Open.

    9. Load or Reload Linetypes, 3dotsandadash .

    10. Select Linetype ( ) 3dotsandadash . t f e n c e . Current (), .

    11. LINE () -. , . . , . 31.2.

    . 31.2. 3dotsandadash

    , , , /

    . . 31.3.

    -- TEMP FENCE

    r t

    TEMP FENCE

    f t

    TEMP FENCE

    . 31.3. ,

    ; , .

    , , . shx.

    , . , ; :

    ; [ , shx-, ];

    : [" " , , ]

    - , , . . 31.1.

    962 VI. AutoCAD

  • . - .

    *TEMPFENCE, - , . 5 , - . 2 5 , [FENCE,"C:\AUTOCAD B I B L E \ F E N C E . S H X " ] , - . 5

    , , ( ). ( ) . AutoCAD , . - , .

    , ( -0.5 ) , { -0.25). ,

    ^ . -| , ,

    . - , ( - Load {)).

    . - .

    TFENCE, , . 5 , - . 2 5 , ["TEMP F E N C E " , F E N C E ] , - 1 . 5

    , , . : - , , . - , ( - ).

    , , , - .

    . 31.1 , , .

    31.1. .

    R=##

    =##

    , ( ), * ( ) ( )

    . , - , 0; , . ( ), ( ) ( )

    . - , , , . - 0, -

    31. 963

  • . 31. 1

    X =##' - , - . . - -,

    Y Y=## , . , .

    * .

    , - , Y.

    * T E M P F E N C E , -

    , . 5 , - . 2 5 , [ F E N C E , " C : \ A U T O C A D B I B L E \ F E N C E . S H X " , S = . 0 2 5 , Y = - . 0 7 ] , - . 5

    , 0,025 . . 31.4. , , . SHAPE , . , .

    , , Y - 0,07 . (. 31.4).

    f t f t f t r t

    . 31.4. TEMPFENCE

    j>f ~'"1||fs. , & -,, ( ), - f e r 1 r .

    , , , - . .

    AutoCAD . \ s u p p o r t \ a c a d . l i n . , - .

    ab3i-a.dwg, - Drawings -.

    . 1. 31- . dwg, -.

    2. ab31-2 . dwg AutoCAD B i b l e . - .

    964 VI. AutoCAD

  • 3. Format^Text Style (^ ). New (), Style name ( ) TVCABLE - . Font name ( ) ArialNarrow. Apply (), Close ().

    4. notepad^ F i l e to e d i t ( ) . AutoCAD Notepad. :*TV, ,.5,-.5,["TV",TVCABLE,S=.3,X=-.1,Y.15],-.75

    5. File^Save { ) AutoCAD Bible ab31-2 . l i n .

    6. Object Properties ( ) Layers (). Layer & Linetype Properties ( ) Buhed_cable Linetype ( ) Continuous. Select Linetype ( ) Load (). AutoCAD B i b l e ab31-2 . l i n , Open.

    7. Load or Reload Linetypes ( -) TV . Select Linetype. Layer & Linetype Properties Current ().

    8. Linetype ( ), Details (), Details. Global scale factor( ) 192. .

    9. . , . . 31.5.

    1

    \i

    \

    1 AJ

    ! -

    - W - ,

    1

    1 : (/). , - .

    _ Center (), .

    (.. Center) .

    \ AutoCAD C e n t e r : (:). , .

    __ Angle (). , . , . AutoCAD .

    33. 989

  • , , - . SELECT (). , SELECT, , Previous () . :

    ID_MoveRight [Move .1 R i g h t ] s e l e c t \raove previous ; . l , 0 ;

    SELECT -. , . .

    . 0,1 ,

    :

    p e d i t \w . 1 ;

    , :

    c i r c l e 2,2 1.5 c i r c l e 6,2 1.5 c i r c l e 10,2 1.5 c i r c l e +14,2 1.5

    , . - CHPROP () , Color() ByLayer. LAYER () - no-p lo t , , .

    chprop a l l bylayer layer f no-p lot qsave

    All () SELECT - .

    () Buttons2 AutoCAD. -

    , 2 :

    ***BUTTONS2// Shift + button

    $P0=SNAP $p0=*

    , AutoCAD. , - . . , . (.. ) Object Snap( ) ( , ). Object Snap - - ( ). , .

    :

    Spa =_. $ =_. *

    , , , , - , . () , -. . 33.3.

    990 VI. AutoCAD

  • ] 33.3. ,

    1-4 () 1 4

    1-4 ( B U T T O N S ) 1 4

    0-999 (POP) 1 499 (0 500-999 )

    I ( I M A G E )

    S ( S C R E E N )

    1-4 1 4

    , Draw. - Surfaces () Draw. Surfaces. image_3dobjects IMAGE.

    ID_MnSurface [->Surfaces]ID__Solid [&2D Sol id]"C A C_sol idID_3dface [3D &Face]AC*C_3dfaceID_3dsurface [&3D S u r f a c e s . . . ]$I=ACAD.image_3dobjects$I=ACAD.*

    , 3D S u r f a c e s .

    , Draw1^Surfaces1^3D Surfaces (^^ ) , , .

    , - , -

    .

    . 33.4 a c a d . mnu.

    ; , . . , - . , - , .

    ; 33.4. acad.

    * * * B U T T O N S I , ( ). ( ) , . , -

    33. 991

  • . 33.4

    ***BUTT0NS2

    ***BUTT0NS3

    ***BUTT0NS4

    ***AUX1

    ***AUX2

    ***AUX3

    ***AUX4

    ***POP0

    ***POP1

    ***P0P2

    ***P0P3

    ***P0P4

    ***P0P5

    ***P0P6

    ***P0P7

    ***P0P8

    ***P0P9

    ***POP10

    ***POP11

    ***POP500

    ***POP501

    ***POP502

    ***POP503

    , ( )

    , ( )

    , ( )

    , , . ( ) , . , -

    , , XShift-f-Haxame >

    , ,

    , ,

    . , -

    ; File ()

    ; Edit ()

    ; a c a d . m n u Wew(Bnfl)

    ; a c a d . m n u insert ()

    ; a c a d . mnu Format ()

    ; a c a d . m n u Tools ()

    ; a c a d . mnu Draw ()

    ; a c a d . m n u Dimension ()

    ; a c a d . mnu Modify ()

    ; a c a d . mnu Window ()

    ; a c a d . m n u Help ()

    ; a c a d . mnu Grips (), - ,

    , AutoCAD

    , AutoCAD,

    , AutoCAD,

    992 VI. AutoCAD

  • . 33.4

    ***504 , AutoCAD, -

    , AutoCAD, -

    , AutoCAD, -

    , AutoCAD, -

    , - AutoCAD,

    , - AutoCAD,

    , - AutoCAD,

    , - AutoCAD,

    . - . a c a d . m n u , . AutoCAD, 29, " "

    ,

    . . , . , . , 33.5 Auto-CAD

    -, ,

    :ELERATORS , - Windows, (, ,, ),

    505

    ***506

    ***507

    ***POF508

    ***509

    ***510

    ***511

    ***TOOLBARS

    ***IMAGE

    ***SCREEN

    ***TABLET1

    ***TAELET2

    ***TABLET3

    ***TAELET4

    ***HELPSTRINGS

    33. 993

  • 2 1 3

    4

    . 33.5. Auto-CAD , -

    , . , , ( ), ( ).

    , BUTTONS1, -

    , ( ) . , .

    ^ " " * * * Buttons Aux , 15 .

    BUTTONS I AutoCAD. AUX1 .

    ***BUTTONS1$=$ ( i f , $ (eq, $ ( s u b s t r , $ ( g e t v a r , cmdnames) , 1 , 5 ) ,GRIP__) ,$P0=ACAD.GRIPS $ P 0 = * ) ;$P0=SNAP $pO = *

    994 VI. AutoCAD

  • DIESEL, , - . ( " " ). -, Grips () - ( ).

    ( ) Object Snap( ). .

    , , . , , . -

    Snap (). , 0, .

    O r t h o (). , AG, .

    . , AD, .

    . , , . -

    . , , .

    . , ,

    , .

    AutoCAD Intellimouse . -

    HBUTTONPAN. , 1, Intellimouse. .mnu- 0.

    , - . , -, , .

    . 1. , , , -

    ! , .

    . 1. acad.mnu, acad.mns, acad.mnc, acad.mnr

    acad.mnl.

    2. acad.mnu, acad.mnu Windows Explorer () (). - Paste (). Windows acad.mnu Copy of acad.mnu , acad.mnu.

    3. a b l . mnu ( , "L"). .

    33. 995

  • 4. acad .mnl a b l . m n l .

    5. WordPad. Start^Run (1^), Wordpad . abl'.mnu. Files of type ( ) All documents (*.*), .

    6. , , * * *MENUGROUP=ACAD. ACAD 1.

    7. , ***BUTTONS3 ***BUTTONS4. , ***AUX3 ***AUX4. - ( ), :***BUTTONS3//Control + "***BUTTONS4//Control -(- shift + nF***AUX3//Control -(- button***AUX4//Control + shift + nF

    Snap , OSNAP .

    8. WordPad.

    9. AutoCAD ( ). Start from Scratch.

    10. menu^. abl .mns Open. AutoCAD : Menu l o a d e d s u c c e s s f u l l y .MENUGROUP: AB1 ( . : 1).

    11. , . SNAP () . , , .

    , . , ,TJa .

    12. . - OSNAP (). OSNAP () "".

    13. .

    14. , menu

  • 15. . , .

    16. .

    POP , .

    ( - ). Snap, , Grips (), , "" ( ) , AutoCAD 2002 .

    & .

    , , , . [ - - ]. , - .

    2 AutoCAD:

    ***2**EDITID_MnEdit [SEdit]

    ID_U [&Undo Ctrl+Z]"CAC_u

    ID_Redo [&Redo Ctrl+Y]"CAC_redo

    [ ]

    ID_Cutclip [Cu&t Ctrl+X]AC'C_cutclip

    ID_Copyclip [SCopy Ctrl+C]AC

    AC_copyclip

    ID_Copybase [Copy with SBase Point]AC"C_copybase

    ID_Copylink [Copy &Link]"CAC_copylink

    ID_Pasteclip [SPaste Ctrl+V] ACC_pasteclip

    ID_Pastebloc [Paste as Bloc&k] AC

    AC__pasteblock

    ID_Pastehlnk [Paste as ^Hyperlink]AC

    AC_pasteashyperlink

    ID_Pasteorig [Paste to Original Coor&dinates] AC

    AC__pasteorig

    ID_Pastesp [Paste SSpecial. . . ] /4C"C_pastespec

    ID_Erase [Cle&ar Del ] "CC_erase

    ID_Lmks [SOLE Links. ..] AC

    AC_olelinks

    [ ]

    I D _ L i n k s [i

  • CapywJi Qua PointTopyL'nk1 i-M - , .

    ' i

    Clivb*|atr All

    Tlnd

    i

    Qil.X

    . " 4

    Dal

    .

    . .. Edit

    Draw (). , Surfaces (), Solids(). Setup (), Solids, - . Profile () Set&up][&Drawing]ffCAC_soldraw[SView]ACAC_solview[

  • . 33.7. Draw Solids Setup

    , . - , . - , , - .

    . 1. acad.mnu, acad.mns, acad.mnc, acad.mnr

    acad. mnl, ,

    !

    . 2, . 1. -, , , .

    2. Notepad. ( Start^Run, Notepad .)

    3. , , , :***MENUGROUP=AB2* * * 1[SAB2]

    4. , , , , - :

    ID_SpecEdits [->&Special Edits]ID__MoveRight [&Move .1 Right ] _select \_move previous ;.l,0;ID_Plinewdth [

  • 5. . ALIGN () , , .

    [--]ID_4circles [&4 circles]_circle 2,2 1.5 _circle 6,2 + 1.5

    _circle 10,2 1.5 _circle 14,2 1.5

    ID_Cleanup [&Clean up]_chprop _all jc _bylayer

    -layer _f no-plot _qsave

    ID_Align [SAlign]AC

    AC_align

    [ ]

    6. . ab2 .mnu AutoCAD2000/Support , . Notepad.

    7. -a.dwg, -. ab33-l .dwg AutoCAD Bible .

    8. Tools^CustomizeOMenus. Menu Groups () Menu Customization ( ) - Browse (). Files of type Menu Template (*.mnu). ab2 .mnu, Open. Load (). AutoCAD Yes () ( ).

    9. Menu Bar ( ). Menu Bar window, . Insert(). AutoCAD . Close, - . , . 33.8. , File Dialogs On.

    10. , AB2oSpecial Edits^Move .1 Right (AB2^^ 0.1 ). S e l e c t o b j e c t s : ( :) - , . - . 33.8. 2 - 0.1 .

    11. AB2^Special EditsOPEDlT.1 (2"=> 1^ 0.1). S e l e c t o b j e c t s : - . AutoCAD 0.1 .

    12. AB2Cleanup (20). AutoCAD ByLayer , .

    13. Tools^Customize^Menus 2.

    14. .

    , - , , ab2 . mnu.

    Tools Customize Menus, 2, .

    1000 VI. AutoCAD

  • , . , . ( - ), - . F I L E D I A 0, , . : AutoLISP, .I D _ M e r r j l o a d [SReload ab2 menu] _ f i l e d i a 0 +_menuunload ab2 menuload ab2.mnu (menucmd +" P 1 0 = + a b 2 . p o p l " ) _ f i l e d i a 1

    , . , - , . - . 2, a b 2 . m n u . . AutoLISP :(menucmd " P n = + m e n u g r o u p . s e c t i o n " )

    POP, ( Help), menugroup - , a section ( P O P I , ).

    ( ) , - POP .

    ,

    .

    ,

    .

    [SObject Snap Cursor Menu]

    [Temporary trac&k point]_tt

    [&From]_from

    [->PoinSt Filters]

    [.X] .X

    [.Y] -Y

    [.Z] -Z

    [.XY].XY[.XZ].XZ[

  • ID_OsnapTang [Tan&gent]__tan[ ]

    ID_OsnapPerpID_OsnapParaID_psnapNodeID_OsnapInseID_OsnapNearID_OsnapNone

    [ 1ID Osnap

    [SPerpendicular]_per[Para&llel]-_par[No&de]_nod[In&sert]_ins[Nea&rest]_nea[&None]_non

    [&Osnap S e t t i n g s . . . ] ' _ + d s e t t i n g s 2

    , Snap - . , .

    AutoCAD , - ( ) ( ). , , , , - , Polyline Edit ( -). , , Spline Edit ( ). , .

    ***500 ***999. ***500 ***511 acad.mns AutoCAD .

    - , ,

    . , -' ?

    AutoCAD .

    (Edit) -

    , , (. 33.9).

    (object menus), - . , . "" - .

    OB JE _ , , OBJECTS^ , . AutoCAD. -: BLOCKREF XREF . - AutoLlSP, :

    (cdr (assoc 0 (entget (car (entsel) ) } ) )

  • 34, " AutoLISP Visual LISP", 35, " AutoLISP", AutoLISP Visual LISP. , AutoLISP, .

    ?.* 1

    \ ' "

    , c i r c l e (), - O3JECTS_circle. acad.mns. ***509, h a t c h ():

    ***509**OBJECT_HATCH

    [Context menu for HATCH object]IC_Hatchedit [&Hatch Edit...]

    nC"C_hatchedit

    . 33.10 , . - , -. , "" , h a t c h - HATCHEDIT.

    . 33.10. hatch

    ,

    . AutoCAD. - "" . AutoCAD -. _, AutoCAD, . , , . -, - . , .

    LINE () PLINE (). , . , PLINE Draw, "" - . - .

    COPY () - . , , Endpoint ().

    . 33.11 , - E n d p o i n t () OSMODE.

    . 33.11. COPY

    33. 1003

  • :***514**COMMAND_COPY

    [ C o n t e x t menu f o r COPY command]ID_Osmode [OSNAP O f f ] ' o s m o d e 0ID_OsmodeEnd [OSNAP E n d p o i n t ] ' o s m o d e 1

    , MOVE () - , , , , - .

    . 1. ,

    WordPad. Start^Run (^), Wordpad . abl .mns \AutoCAD 2002\Support. File^Save As ab2.mns. Windows Explorer a b l . m n l \AutoCAD 2002\Support. Windows Explorer - ab2 .mnl. ..

    /-" . , , - : .1. , , ! , .

    2. , , - acad.mnu, acad.mns, acad.mnc, acad.mnr acad.mnl \AutoCAD 2002\Support. acad.mns Windows Explorer (). Paste(). Windows acad.mns Copy ofacad.mns . ab3.mns. acad.mnl : ab3.mnl. - WordPad. Start^Run, Wordpad . .mns \AutoCAD 2002\Support.

    3. ***MENUGROUP=. - .

    4. ***512, **0BJECT_LWPOLYNINE. 512, ***TOOLBARS . . :***513**OBJECT_3DSOLID

    [Context menu for 3DSOLID object]ID_Hide [&Hide]"C"C_hideID_VPointSE [SE &Viewpoint] ACC__vpoint 1,-1,1ID_VPointTop [Top Vie&wpoint]AC"C_vpoint 0,0,1

    5. File^Save. . mns TextDocument WordPad.

    6. AutoCAD, . Start from Scratch.

    1004 VI. AutoCAD

  • 7. Draw^Solids^Box (^^>) - .

    8. menu

  • (. 29,

    " "), . a c a d . mnu, :

    **TB_STANDARD**TB_STANDARD_TOOLBARID_TbStandar [_Toolbar("Standard Toolbar", _Top, _Show, C, 0, 1)]ID_New [_Button("New", "ICON_16_NEW", "ICON_16_NEW"}]*C

    AC

    ID_Open [^Button("Open", "ICON_16_OPEN","ICON_16_OPEN")]_ID_Save [_Button("Save", "ICON_16_SAVE","ICON_16__SAVE") ] *C*C_qsave

    [~]ID_Print [_Button("Plot", "ICON_16_PRINT","ICON__16_PRINT")]"C'C_plotID_Preview [_Button("Print Preview", "ICON_16_PREVIEW",11 ICON_1 6_PREVIEW" } ] AC"C_previewID_TextFind [_Button ( "Find and Replace", "ICON__16JTEXTFIND" ,"ICON_16_TEXTFIND")]ACAC_find

    [ ]ID_Cutclip [_Button("Cut to Clipboard", "ICON_16_CUT",

    "ICON_16_CUT")]_1:11

    ID_Copyclip [_Button("Copy to Clipboard", "ICON_16_COPYM,

    "ICON_16_COPY")]"_11

    ID_Pasteclip [^Button("Paste from Clipboard", "ICON_16_PASTE","ICON_16_PASTE")]

    AC

    AC_pasteclip

    ID_Matchprop [_Button("Match Properties", "ICON_16_MATCH","ICON_16_MATCH")]'_matchprop

    t ]

    ID_U [^Button("Undo", "ICON_16_UNDO","ICON_16_UNDO")]"C"C_uID^Redo [__Button("Redo", "ICON_16__REDO","ICON_16_REDO")]"C

    AC_redo

    ID_Today [_Button("Today", ICON_16_TODAY,ICON_16_TODAY)]

    _

    ID_PointA [_Button("Autodesk PointA", ICON_16_WHISTLER,ICON_16_ WHISTLER)]"C^C_browser http://pointa.autodesk.comID_MeetNow [_Button("Meet Now", IC0N_16_MEETN0W,IC0N_16_MEETN0W)]"C"C_MeetNowID_Publish [_Button{"Publish to Web", IC0N_16_PUBWEB,IC0N_16_PUBWEB)]'C

    nC_PublishToWeb

    ID_Etransmit [_Button ("eTransmit", IC0N__16_ETRANSMIT, IC0N_16ETRANSMIT) ]

    4C'

    4C_etransmit

    ID_Hyperlink [_Button("Insert Hyperlink", "IC0N_16_URL","IC0N_16_URL")]"C"C_hyperlink

    [ ]

    ID_TbOsnap [_Flyout("Object Snap", IC0N__16jDSNAP,IC0N_16_0SNAP, _0therlcon, ACAD.TB_OBJECT_SNAP)]ID_TbUcs [_Flyout("UCS", IC0N_16_UCS, IC0N_16_UCS,_0therlcon, ACAD.TB_UCS)]

    [ ]IDJTbViewpoi [_Flyout("Viewpoint", IC0N_16_DDVIEW,IC0N_16_DDVIEW, _0therlcon, ACAD.TB_VIEWPOINT)]

    1006 VI. AutoCAD

  • . , (/), , (/) .. , AutoCAD, .

    00*"* , , AutoCAD, MNS-.

    . . , - . .

    : -. o t h e r l c o n , , , "" (.. ). Ownlcon, , , . , .

    Windows , .

    Keypad, , @

  • . i m a g e _ 3 D o b j e c t s IMAGE acad.mnu,

    * * * IMAGE* *image_3DObj ects[3D Objects][acad(Box3d,Box3d) ]

    _._

    [acad(Pyramid,Pyramid)]"OAC_ai_pyramid

    [acad(Wedge,Wedge)]ACAC_ai_wedge

    [acad(Dome,Dome)]ACAC_ai_dome

    [acad (Sphere, Sphere) ] "CAC_ai__sphere

    [acad(Cone,Cone)J _1_

    [acad(Torus,Torus)]"C"C_ai_torus[acad(Dish,Dish)]ACAC_ai_dish[acad(Mesh,Mesh)j ACC_ai_mesh

    , , . 33.12.

    3D Objects

    . 33.12. 3D Objects (3M ) IMAGE

    , - ., 3D Objects, AutoCAD - Draw:

    ID__3'dsurf [&3D S u r f a c e s .$I=ACAD.*

    Sl-ACAD.image 3 d o b j e c t s

    3D Objects .AutoCAD . 20 ,

    AutoCAD Previous () Next (). , .

    , . , 3 2 , .

    '-'.,. -b.dwg, ab4.mnu, -01.dwg ab33-bl7.dwg - 0 1 . s l d -17.s ld , - Drawings -.

    1008 VI. AutoCAD

  • . 1. acad.mnu, acad.mnc, acad.mnr acad.mnl

    ( ).

    !

    . 1. , , , .

    2. Notepad ab4.mnu, -. 2 , Image 1, (. 33.13). , - INSERT. ab4 .mnu, -, . ab4 .mnu.

    HENUGR0UP-AB4"01

    I D S p e c E d i t s [ - > & S p e c l a l E d i t s ]ID_HooeRight [ .1 Right]"C"C_select \_noge preuiouslu_Plinewdth [

  • , AutoCAD Tools Options (^) Files (), Support File Search Path ( ), Browse (), Add ().

    4. -b. dwg, -. - 40 ( 14 ) 30 ( 10 ), .

    5. 3-2 .dwg AutoCAD Bible .

    6. ToolsoCustomize^Menus. File name () Menu Groups ( ) ab4.mnu Load (). - AutoCAD, . , , Yes ().

    7. Menu Bar ( ). 4 - Menu Group ( ). Menu Bar Window () Insert (). AutoCAD 4 Window (). Close.

    8. 4. , Architectural ElectSymbols ( ). , Architectural Electrical Symbols, - Image (. 33.14).

    1:* : ". * -

    Dryer Outlet

    S u r f a c e M o u n t e d L ight

    R e c e s s e d L ight

    W a i W a s h e r Light

    R e c e s s e d E y e B a l l Light

    P e n d a n t L ight

    W a l l M o u n t e d L ight

    S c o n c e

    Ffood L ights

    T h e r m o s t a t

    Single P o l e S w i t c h

    T h r e e - W a y S w i t c h

    Master S w i t c h

    Exhaust F a n

    S m o k e D e t e c t o r

    W h o l e H o u s e Fan

    . 33.14. Architectural Electrical Sym-bols, Image

    9. , , ***AEC_sym, . 33.13. , l a b e l t e x t () . .

    1010 VI. AutoCAD

  • 10. . . . . .

    . 4^Architectural Elect Symbols. - . . - . , , .

    12. Tools^Customize^Menus 4. - .

    . -

    AutoCAD 2002\Sample\Tablet2000.dwg TABLET acad.mnu. , . 9 25 . - TABLET () , - 9 25 , .

    - 16, " ".

    TABLET 1 acad.mnu:

    ***TABLET1*-TABLETlSTD[A-l]\[-2]\[-3]\[-4]\[-5]\[ - ] \[-7]\[-8]\[-9]\[-10]\

    1 25. TABLET2 :

    // TABLET2.// : J R {9}// : 11//***TABLET2**TABLET2STD// J View_'_zoom __e'_zoom _a1_zoom _w'_zoom _p[Draw]

    ACC_box

    33. 1011

  • CAC_mtext

    11

    , , . - , . ( , T a b l e t 2 9 11 .) - . -, .

    ^ ^ ^ , Tablet2000 .dwg, AutoCAD 2002\Sample\,

    . , - , .

    , . -

    , , - ***SCREEN acad.mnu.

    . , - acad.mnu , -

    ^ . acad.mnu.

    ***HELPSTRINGS

    , . . HELPSTRINGS acad.mnu. , .

    ***HELPSTRINGSID_3dcordit [Starts the 3DORBIT command with continuous orbit

    active in the 3D view: 3DCORBIT]

    ID_3ddistanc [Starts the 3DORBIT command and makes objects appear

    closer or farther away: 3DDISTANCE]

    ID_3dface [Creates a three-dimensional face: 3DFACE]

    ID_3dmesh [Creates a three-form polygon mesh: 3DMESH]

    ID_3dorbit [Controls the interactive viewing of objects in 3D:

    3D0RBIT]

    ID__3dpan [Starts the 3DORBIT command and enables you to drag

    the view horizontally and vertically: 3DPAN]

    ID_3dpoly [Creates a polyline of line segments in 3D space:

    3DPOLY]

    ID_3dsin [Imports a 3D Studio file: 3DSIN]

    ID_3dsurface [Creates three-dimensional surface objects using a

    dialog box]

    ID_3dswivel [Starts the 3DORBIT command and simulates the

    effects of turning the camera: 3DSWIVEL]

    ID_3dwievs [Sets the view to a predefined or named view]

    1012 VI. AutoCAD

  • acad.mnu , , - , . , , - . - , .

    ab4.mnu, Drawings -.

    . 1. acad.mnu, acad.mnc, acad.mnr acad.mnl

    ( ).

    . 1. , , ,

    ! .

    2. Notepad .mnu, -. ab4 . mnu , .

    3. . ab4.mnu, , , .***HELPSTRINGSID_MoveRight [Moves se lected objects .1 unit to the r ight]ID_Plinewdth [Makes the width of one polyl ine .1]ID 4circ les [Draws 4 c i r c l e s in one row with radius 1.5]ID_Cleanup [Changes color of a l l objects to BYLAYER, freezes no-plot layer, and saves]

    ID_Align [Moves and r o t a t e s objects to al ign with other ob jects :align]ID__AEC_sym [Inserts AEC electr ica l symbols using a dialog box]

    4. , ab5.mnu , ab4.mnu. ab4 .mnu, -, ab5 .mnu - \Program Files\AutoCAD 2002\Support , AutoCAD. , - - 4. Notepad.

    5. AutoCAD . Tools^Customization^Menus. File name abS.mnu Load. Yes (). AutoCAD .

    6. Menu Bar ( ). Menu Bar - Window Insert (). AutoCAD - Window. Close.

    7. 4 , . .

    8. 4. .

    33. 1013

  • ( )

    * * * ACCELERATORS. acad. mnu.

    ***ACCELERATORSID_Hyperlink [CONTROL+"K"][CONTR0L+"L

    M]"0

    [C0NTR0L+MR"3"V

    ID_SellAll [CONTROLS"A"]ID_Copyclip [CONTROL+"C"]ID_New [CONTROL+"N"]ID_Open [CONTROL+"0"]ID_Print [CONTROL+"P"]ID__Save [CONTROL + "S

    M]

    ID_Pasteclip [CONTROL+"V"]ID_Cutclip [CONTROL+"X"]ID_Redo [C0NTR0L+

    MY"3

    IDJJ [CONTROL+"Z"]ID_Ai_propch [CONTROL+TOOLBAR+"I

    ]

    ID_Modify [CONTR0L+"!"]ID_Content [C0NTR0L+"2"]ID_dbConnect [C0NTR0L+"6"]ID__VBARun [ALT+"F8"]ID_VBAIDE [ALT+"F11"][ C O N T R O L + " H " ] ' _ s e t v a r ; p i c k s t y l e ; S M = $ ( i f , $ ( g e t v a r , p i c k s t y l e ) , 0 ) , 1 $( i f , $ ( e q , $ ( g e t v a r , p i c k s t y l e ) , l ) / 0 , $ ( i f , $ ( e q , $ { g e t v a r , p i c k s t y l e ) , 2) , 3 , 2 ) ) }

    , , i - * , , -tta . , , -

    , (.. ), , AV (.. - ). - , Windows - AutoCAD .

    .

    , ID_Spell , - .

    , [CONTROL+"L" ], - , . - , .

    . 33.5 , , .

    33.5. , A C C E L E R A T O R S

    F1-F12 "F1", "F2" .., "F10", Windows

    Insert "INSERr

    1014 VI. AutoCAD

  • . 33.5

    Delete

    -

    "DELETE"

    "UP", "DOWN", "[.", "RIGHT";

    "NUMPADO", "NUMPAD1" .. UNUMPAD9"

    )

    Win-dows, , ..

    Release 2000i, AutoCAD - .

    -!

    Keyboard () - Customize (), . 33.15. , - Tools^CustomizeO Keyboard (1^^). , .. .

    Conrnmbj TmbMtj PrapaitetCattaatm i

    . 33.15. - ( ) - Keyboard Customize

    - .

    1. Categories () . AutoCAD Commands

    33. 1015

  • ( AutoCAD), , - AutoCAD . . , Draw () Circle () Arc (), - Draw.

    2. Commands () , - .

    3. Press New Shortcut Key ( ). . - - , , .

    4. Assign ().

    5. .

    6. , - Close, .

    .mns- , - Menu Group ( ). , - , Windows Standard Accelerator Keys( Windows) User Preferences () Options (), , Tools Options (1^ ). , .

    Current Keys ( ) Customize Remove (). , Show All ( ).

    abS.mnu, Results -.

    . 1. acad.mnu, acad.mnc, acad.mnr acad.mnl

    ( ).

    . 1. , , ,

    ! 0 .

    2. Notepad ab5.mnu, -. ab5 .mnu , .

    3. , .

    ***ACCELERATORS[CONTROL+"E"]'osmode 1[CONTROL+"3"]'osmode 7[CONTROL "up"]'snap 1[CONTROL "down"]'snap .25

    1016 VI. AutoCAD

  • osmode 1 Endpoint () , osmode 7 , .

    4. , ab6 .mnu , ab5.mnu. 5., -, . \ProgramFiles\AutoCAD 2002\Support , AutoCAD. , - - 4. Notepad.

    5. , Start from Scratch. Tools^Customize^Menus. , Replace All( ). File name ( ) Menu Group( ) . Load (). Yes (). AutoCAD ,

    6. Menu Bar ( ). Menu Bar - Window Insert (). AutoCAD - Window. Close.

    7. Tools^Customize^Keyboard. Menu Group ACAD. Categories () - Render (). Commands () Hide ().

    8. Press New Shortcut Key. . Assign () Close (), .

    9. ( " " - ). AutoCAD , 1. . AutoCAD , 0,25. ( , , , . SNAP, - Grid Snap On.)

    10. OSNAP Settings() . Drafting Settings .

    11. . LINE. Specify f i r s t p o i n t : ( :) . . - Speci fy n e x t p o i n t or [Undo] : ( []:) .

    12. . ; LINE.

    13. BOX . -, Standard, SE Isometric View. . AutoCAD , HIDE.

    14. Tools^Customize^Menus, 4. .

    33. 1017

  • , ,

    . -. , . - : , -, .

    VI, AutoCAD. VII, , AutoCAD AutoLISP.

    1018 VI. AutoCAD

  • AutoCAD

    VII - AutoLISP, Visual LISP Visual Basic for Appli-

    cation, AutoCAD. AutoLISP -, - . AutoLISP Visual LISP. - AutoLISP, , .

    Visual Basic for Application Windows. - AutoCAD, ActiveX - AutoCAD Windows .

    pdf - -.

    . 34.

    ' !

    ' !

    35.

    20

    , " .

  • . .'

    .

    .

  • AUI01/AU

    ;[ AutoCAD Today.;

    AutoCAD

    , , . AutoCAD 2002 -, - - CD-ROM -. - , AutoCAD .

    AutoCAD 2002 . - - Windows Explorer \Netsetup -, Readme, t x t , - Setup. , AutoCAD . , - AutoCAD 2002 Administrators Guide, \Net setup\ support \AdLM\Docs\acad_netguide .chm \Netsetup\support\AdLM\Docs\acad_netguide.htm (.. ).

    AutoCAD AutoCAD :

    , - .

  • AutoCAD , AutoCAD , ,

    , , , .

    . Pentium 233 (); Pentium 450 - ().

    . 32 (), 64 (). "" 128-256 .

    . 800x600 VGA 256 (); 1024x768 SVGA 64 000 ().

    . 130 ; - 60 (), 75 (); - 20 .

    . , , - .

    CD-ROM. .

    . GL- ; -; ; Internet; , - AutoCAD; Web- Microsoft Internet Explorer 5.0,Netscape Navigator 4.5 . ( Auto-CAD Internet Explorer 5.5.)

    , , AutoCAD, Windows, . Windows NT/2000 Administrators Power Users.

    AutoCAD 2002 AutoCAD 2000i.

    ^ l l l i 1 - AutoCAD 2002 - AutoCAD 2000 20001. Release 14 -

    ! AutoCAD 2002. \> psfP'' 2000 20001,

    , , - , - \Previous Version Custom F i l e s .

    , AutoCAD . AutoCAD , - , , -, Readme. ( - !)

    readme- AutoCAD, - Windows Explorer readme.hip,

    , . -.

    . AutoCAD 1023

  • AutoCAD

    , , , - Next (), .

    AutoCAD 2002 .

    1. - AutoCAD CD-ROM. - , Windows - -. , Start^Run(), d:\setup< , d CD-ROM.

    2. (Welcome) - , . - Next ().

    3. AutoCAD. , , I accept(), Next.

    4. Serial Number ( ) -, . Next.

    5. Personal Information ( ) ( -), , . Next.

    6. AutoCAD, AutoCAD 2002 ( ) 2002. ( , Release 14, AutoCAD 2000 2000i - AutoCAD 2002 . 2000 2000i .)

    7. .

    Typical (). - .

    Full (). .

    Compact (). - , .

    Custom (). - , .

    8. , . Auto-CAD 2002 .

    Program F i l e s . , , , , , - TrueType, , , , 86 .

    Texture maps (). , - 13 .

    CAD Standards Extensions ( ). , 1,6 .

    1024 VIII.

  • XML/DATA Extension ( XML/DATA). - Web, 512 .

    Fonts (). AutoCAD 5,4 .

    VBA Support ( VBA). Visual Basic for Applications 6 .

    Volo View Express ( Volo View Express). - AutoCAD, Internet ( DWF). 1 .

    Batch Plotting ( Batch Plotting). , 448 .

    Database ( ). , 7 .

    Tutorials (). AutoCAD, 1 .

    Dictionaries (). , 448 .

    Samples (). , , - 1,8 .

    9. AutoCAD 2002 :

    ( , , , , );

    Internet ( Volo View Express);

    External Database;

    Visual Basic;

    Batch Plotting

    Portable License Management - ;

    , DesignCenter AutoCAD;

    ;

    .

    10. , .

    11. Next.

    12. , Custom Components( ) , -. , , , , - . Next. - - .

    13. ( AutoCAD 2002). , Disk Costing ( ), , -

    . AutoCAD 1025

  • , , . . 1. , Next.

    Sid:OE:OF:

    2047MB241874MB

    916MB1019MB570MB

    141MB10KB

    777MB1019MB570MB

    . A.I. Disk Costing - , - AutoCAD, - ( ) , - AutoCAD

    14. Start Installation , . , , - Next.

    15. , . .

    16. Microsoft NetMeeting, 3.01. , MeetNow AutoCAD 2002.

    17. Volo View Express. DWF-, Publish to Web. - Volo View Express . - Volo View, . ( Volo View , , Volo View Express.)

    18. , , Readme-, - . Finish (). - , Readme-. ( - Readme- , - Help^Help (^) Contents(). G e t t i n g I n f o r m a t i o n( ), Use Help ( ) - AutoCAD 2002 Readme,)

    19. . , Yes (), , No(). , AutoCAD - . !

    Startc*Programsc>AutoCAD 2002 (-^AutoCAD 2002) AutoCAD 2002.

    1026 VIII.

  • , , AutoCAD 2002 - ;

    AutoCAD 2002 AutoCAD;

    Batch Plot Utility ( Batch Plot) , - ;

    CAD Standards Checker ( ) , ;

    AutoCAD - .

    1. Starts Settings ^Control Panel (^) Add/Remove Programs( ),

    2. Jnstall/Un/nstall ( - ), AutoCAD 2002 Add/Remove(/). ( Windows 2000 Change ().)

    3. Add/Remove Application Add or RemoveFeatures ( ) Next ().

    4. AutoCAD 2002 Setup ( AutoCAD 2002) . Next.

    5. Start Installation ( ) Next.

    6. Finish ().

    , .

    AutoCAD AutoCAD, - Autodesk ) Authorization Code. - 15 . - AutoCAD . , . , - Authorize AutoCAD 2002 Next, , , - . AutoCAD.

    I Internet. Autodesk Internet. .

    f . , - Autodesk.

    . AutoCAD 1027

  • . , , Autodesk.

    . , - Autodesk .

    . , - ( ).

    AutoCAD . -. AutoCAD ToolS"=>Options (^), Options(), .

    AutoCAD AutoCAD Options (), -

    , CONFIG(). - , , Apply (). , , .

    ^00** , , - . -

    , . / Windows.

    Options. , . .

    Options (), . -

    Options ().

    Files . .2 Files (), nyi

    , . Support File Search Path ( ), , AutoCAD , , , . AutoC.2002\Support , *, AutoCAD .

    . "+" .

    1028 .

  • Windows - , Add (). Browse (). , .

    Curentprefi

    -

    + fe+ fa

    L+ n+. D-+ D+ to+ ^+ to+ to- to

    laodptoHi

    to Ebn ' ,-"',y;:r *> :,-*'': pSj^ij'OpenandSeyej Hhj}j Sjratemj UPfenast]

    Supporl FileSeaich Path

    Working Support File Search Path

    Pro|ecl F*es S eaich Palh

    Menu. Help, and Miscelaneous File Names

    Texl Editor. Dicbonaiy. and FoW File NamesPrnl F

  • IK lOiitiorts > in>p.. 'f V

    "-.

    " '

    1 J

    . -

    .

    T

    . '

    i

    l ; L I V'

    " I

    *

    ' .

    #

    . . . .

    * < *

    : : ! " " J : '

    A i m . *

    . . .

    3 @ t s

    ^ !

    j

    *

    J

    *

    *

    :

    v ' I -

    V !

    ' . ^ 1 1 #

    j ^ M ~~- . .

    * - r a!

    * 41 f~4

    * n l i p r

    i J ^ J

    -

    | 1 f t "

    V J

    - * '

    '.

    /'. .5. Display Options

    Display resolution ( ) ( VIEWRES), - ( SPLINESEGS), - ( FACETRES) - ( ISGLINES).

    Display performance ( ) , . , / FILLMODE, - , , .

    Reference Edit Fading intensity - . , . 19, " ".

    Open and Save Open and Save ( ), . .4, -

    , AutoCAD , .

    File Save ( ) - . - , AutoCAD 2002, ,, - AutoCAD, , 13 14. AutoCAD 2000, 2002 .

    AutoCAD , Select File ( ) . Save thumbnail preview image ( ) .

    1030 VIII.

  • Wjt * V

    I- X

    i

    1 P

    >- n'lkllt M

    . .4. Open and Save

    Incremental save % (% ), - . - , . 50%, - .

    File Safety Precautions ( ) Minutes between saves ( ()) 20 . , -, Files.

    AutoCAD Create backup copy witheach save ( ). , -, - . bak. - , , - . . dwg . ,

    () .

    , , - Full-time CRC validation ( CRC). -, .

    Maintain a log file ( ) . - AutoCAD . , . , , Files.

    . AutoCAD 1031

  • , AutoCAD - . . $, File extension for temporary files ( ). , , Files.

    External References (Xrefs) ( ) / - ( XLOADCTL). , , - . External reference file de-mand load ( ) Enabledwith copy ( ) , .

    Retain Changes to Xref Layers ( ). , (, f reez) . . - , . 19, " ".

    ObjectARX Applications ( ObjectARX) , AutoCAD ObjectARX , . ObjectARX AutoCAD. RENDER. , ARX-. ObjectARX. , , , , , . , .

    Proxy images for custom objects , -, . Show Proxy Information dialog box, AutoCAD Proxy Information -, , .

    Plotting . .5 Plotting ( ) , -

    , . , .

    Default plot settings for new drawings ( - ) ( -). , -, . AutoCAD 2002 . Add or Configure Plotters - Add-a-Plotter Wizard .

    General plot options ( ) , AutoCAD, -, , , -, - , - .

    1032 VIII.

  • *"* jmj^ *-

    lit iirige LV ski I'J -afar , j

    Vl V 'A

    J

    . .5. Plotting

    OLE plot quality - OLE-, Text. - Line Art ( ), Graphics (), Photograph () High Quality Photograph ( ). Use OLE ap-plication when plotting OLE objects ( OLE- OLE-) , OLE- . , Hide system printers ( ), Plot () Page Setup ( ) Windows. - , .

    -. 17, " - ". , - . 0 . P l o t S t y l e s , , Add or Edit Plot Style Tables. Add-a-Plot Style Table Wizard.

    System System ,

    AutoCAD (. .6). Current 3D Graphics Display ( ) -

    , AutoCAD. - HEIDI, AutoCAD. Properties .

    . AutoCAD 1033

  • I ,

    \ '

    . .6. System Options

    Current Pointing Device ( ) -, AutoCAD . , , Wintab Compatible D i g i t i z e r ADI4 .2. , Digitizer only( ) . ( - .) Digitizer andmouse ( ) , .

    - Windows wintab., , Windows.

    Layout Regen Options ( ) Mode! () .

    General Options .

    Multiple Document Interface, . ( , AutoLISP- .)

    Display OLE properties dialog, OLE properties OLE-.

    Show all warning messages, - , Don't displaythis warning again ( ).

    1034 VIII.

  • on errors in user input AutoCAD - .

    , acad. l s p ( Load acad.lsp into every drawing). - , - acaddoc . l s p .

    Allow long symbol names , , , , -, , , . - .

    AutoCAD Today (AutoCAD ) Startup(). Live Enabler Options Point Autodesk.

    dbConnect Options Store links index in drawingfile , . , . , . , Open tables in read-only mode ( ) - . ,, , - AutoCAD .

    User Preferences User Preferences, . .7,

    .

    Puc. A. 7. User Preferences Options

    . AutoCAD 1035

  • Windows Standard Behavior ( Windows) - , .. , , Windows, , - AutoCAD. , - COPYCLIP -, Windows. ( , ) AutoCAD.

    . , - .

    Right-click Customization , - . .8.

    I Right Click Customization

    I; obpcli e-'e wfeded. a^t- mew*

    i~ * Lad Command

    Ifgnezi tit Repeat UaConrand .P Shortcut

    H a command ij'np(O(*e.i#*-cfcfc mean* '

  • AutoCAD DesignCenter User Preferences -, - ( Source contents units) ( Target drawing units) - AutoCAD DesignCenter. AutoCAD , INSUNITS 0. ( ), - AutoCAD DesignCenter .

    Hyperlink, Display hyperlink cursor, ( , - "" ), Display hyperlink ToolTip, .

    Priority for Coordinate Data Entry . - OSNAP () , -, , - Keyboard entry except scripts ( ( )). - , , .

    Object Sorting Methods , AutoCAD . ( Plotting) PostScript ( Post-Script output). Object selection, AutoCAD - . , , , . .

    Assosiative Dimensions ( ) , , - .

    Lineweight Settings - , . .9.

    Lineweinht Settingsf Urix fa Latino

    E l CurontLJner*V :.

    . .9. Lineweight Settings

    11, " , , ".

    Lineweights . Auto-CAD ByLayer, ByBlock Default. - LWDEFAULT Default, -

    . AutoCAD 1037

  • 0,01 0,25 . - Default. Default , - . Units for Listing () Millimeters () Inches (). , , , , . Display Lineweight( ) LWT - AutoCAD - . , - .

    Default , AutoCAD .

    Adjust Display Scale - Model . . Model - - . - , . , .

    Lineweights. , -

    .

    Apply & Close. - User Preferences Options.

    Drafting Drafting, . , -

    AutoSnap AutoTrack. AutoSnap Settings (, -

    , ), . AutoSnap, . . , AutoSnap. , . . - AutoSnap. .

    AutoTrack Settings - AutoTracking.

    Display polar tracking vector, -, , , - . .

    Display full-screen tracking vector, - .

    Display AutoTrack tooltip, - , .

    1038 VIII.

  • . . 10. Drafting Options

    Alignment Point Acquisition "" AutoCAD , . - , .

    AutoCAD .

    Selection Selection (. .)

    .

    , , - 9, ": ", 10, " - ".

    Profiles . . 12 Profiles () -

    . , Options. - - . , .

    , Options, - Unnamed P r o f i l e( ), AutoCAD. .

    . AutoCAD 1039

  • I, 114. " I

    . ^.//. Selection Options

    O w n ! profile* Hhn ' , ' *W'!'.'- . ' ''*

    UmamedProtile>>

    Addtoljtt.--"

    -WAe , '

    Caned

    . . /2. Profiles

    1. Add to List ( ). AutoCAD Add Profile ( ). - , Apply & Close.

    2. Profiles Set Current().

    /040 VIII.

  • 3. , Options. He Apply ().

    4. Options.

    Profile Options, Set Current (). , . , - ( - AutoCAD, - ).

    , - .

    AutoCAD, , AutoCAD -

    Windows , , DOS. :

    C:\Program Files\AutoCAD 2002\acad.exe

    , - , AutoCAD.

    , (switches),

    AutoCAD. - acad.exe . . .

    .1.

    / / : \ s t e v e \ s t e v e . c f g ( ) -, . - -

    / /s c : \ s t e v e , , AutoLISP, . , - , - , AutoCAD

    . AutoCAD 1041

  • . A.I

    /b "Union H i l l A p t s " /b ( s e t u p " U n i o n H i l l A p t s " )

    ( setup).

    /t /t a - t b ( a - t b )

    / n o l o g o AutoCAD

    /v "Union H i l l A p t s " /v f r o n t

    / / AutoCAD - ,

    / / s t e v e AutoCAD ( steve). AutoCAD, - Profile() Options ()

    . , - "Union H i l l Apts" :

    C:\Prograra FilesVAutoCAD 2002\acad.exe "c:\drawings\Union HillApts.dwg" /v front /b setup

    Win-

    dows . Windows Explorer() acad .exe ( AutoCAD 2002), CreateShortcut ( ). Windows S h o r t c u tto acad.exe . Windows : -, AutoCAD 2002 AutoCAD.

    .

    1. .

    2. Properties ().

    3. Shortcut ().

    4. Target () DOS.

    5. .

    AutoCAD , - .

    c:\Program Files\AutoCAD 2002\acad.exe /nologo /t "My templa te"

    1042 VIII.

  • AutoCAD

    ( acad2002 . cfg), ASCII , , . AutoCAD 2002 /, , , . - . . 13 .

    \ acad2002.du Notepad

    C o n f i g u r a t i o n f o r AutoCAD 2002 ( ) H i c c o s o f t Windows; D:\PROGRfiM FILESVfiUTOCHD 2eO2\acad28e2.cfg created on 6/11/2081 at11:42:32

    [flppData]

    [Uersion]Platforn=Microsoft Uindous

    FileUersion-8

    ExecutableDate&Tine-junkjunkjunkjunk

    [AutoCAD]CFgStanp-:tt9K 5X0fluthorizationCode- [Digitizer/Driver]'Current System P o i n t i n g DeuicePat i iHane- interna l

    [Editor]i

    [Menu]T HentiO

    . . 13.

    , -, .

    , - AutoCAD. , AutoCAD - , - .

    , / . .

    1. Windows Explorer - , , acad2002-orig . cfg.

    2. AutoCAD - Options ().

    3. AutoCAD.

    4. Windows Explorer - acad2002. cfg. , , L a r g e D i g i t i z e r . cfg.

    . AutoCAD 1043

  • 5. , - acad2 0 0 2 - o r i g . cfg acad2002 .cfg.

    . ( .) , , .

    .

    .

    .

    .

    -, AutoCAD, - , -- .

    , , - .

    .

    , , - .

    , .

    , AutoCAD, - :

    C:\Program Files\AutoCAD 2002\acad.exe /t acad /nologoC:\Program Files\AutoCAD 2002\acad.exe /p Steve /c Steve.cfg /t arch

    acad.dwt - , .

    , a r c h . dwt , s t e v e s teve.

    , . -

    , AutoCAD.

    Windows .

    , Start^SettinQS^Printers Add Printer. Windows.

    1044 VIII.

  • Windows , -. AutoCAD , . Windows .

    ^000"^ AutoCAD Windows DesignJet Hewlett-Packard.

    Plotter Manager Plotter Manager .

    - . Plotter Manager .

    Windows Start^SettingsOControl Panel Autodesk Plotter Manager.

    AutoCAD File^Plotter Manager(1^ ).

    AutoCAD Tool SO Options. Plotting Options Add or Configure Plotters( ).

    Plotter Manager , "" . Add-a-PlotterWizard. , .

    Setting Up Plotters and Printers( ) 6 AutoCAD Help Installation Guide( AutoCAD), - . Help^AutoCAD Help^lnstallation Guide^Chapter 6.

    - 2- -, AutoCAD.

    - .. AutoCAD 2 0 0 2 \ P l o t t e r s . , - (, ). - . Plot Device Plot.

    Plotter Manager Edit PlotterConfiguration ( ); . - Calibrate Plotter ( ).

    . AutoCAD 1045

  • , , -

    .

    , Edit Plotter Configuration( ) Plotter Manager.

    File^Page Setup (^ ). - Plot Device Properties ().

    Plot . Plot Device Properties ().

    Windows Explorer -. AutoCAD 2 0 0 2 \ P l o t t e r s .

    . ASCII-. , , Plotter Configuration Editor( ).

    General () . . , .

    Ports () , - , - (AutoSpool). , , .

    Device and Document Settings ( ) , .

    , Plotter Configuration Editor , . , , , .

    Media ( ). .

    Physical Pen Configuration ( ). , - -, , .

    Graphics (). ( ), - , .

    Custom properties ( ). . Windows , ( ).

    Initialization Strings ( ). - . , , .

    User-Defined Paper Sizes and Calibration ( -). , .

    1046 VIII.

  • , - -. Save As - -. Default ( ) - .

    AutoCAD Today AutoCAD Today (AutoCAD ) AutoCAD

    , . - , , , - \ N e t s e t u p - AutoCAD 2002. , AutoCAD, , AutoCAD . Configure To-day ( AutoCAD Today) ;

    Bulletin Board ();

    Bulletin Board ( , AutoCAD Today - Web );

    Point Autodesk;

    , .

    TodayManager (AcTodayMgr.exe), - AutoCAD 2002.

    . AutoCAD 1047

  • AutoCAD

    f ...*" |j&, -;;|" AutoCADJ . _.;; . V\' :.:;."/* .- *'.' '';. AutoCAD -,.,,,., . ." .;."-?,--[ f . . Internet ^ f r .

    ^ > - ? 5 : -

    . .

    , AutoCAD,

    , - AutoCAD, - .

    AutoCAD

    AutoCAD , - , . AutoCAD, , , , .

    AutoCAD

    . , - . - AutoCAD , .

    . , - 14 Auto-CAD 2002, 200 2000i .

    - AutoCAD

  • Autodesk , , , .

    Autodesk (Authorized Training Center), - . , -, .

    AutoCAD

    , . . Auto-CAD .

    Autodesk Autodesk University , AutoCAD. - , Web- : h t t p : //www. autodesk. com.

    Autodesk . - , . - . "" AutodeskLearning Assistance, Try It () AutoCAD. h t t p : / / e - l e a r n i n g . a u t o d e s k . com/eLearnMain.asp. h t t p : / / e - l e a r n i n g . a u t o d e s k . com/defaul t , asp.

    AutoCAD, -

    . AutoCAD, .

    AutoCAD :

    CADENCE CADALYST. ( , -), Web-, .

    , upFront.eZine, - (Ralph Grabowski) , - . ralphg@xyzpress . com s u b s c r i b e upf r o n t .

    Autodesk

    . , - . - , , Autodesk .

    . AutoCAD 1049

  • AutoCAD AutoCAD (AutoCAD User's Groups AUGs)

    , , , - , AutoCAD.

    - Silicon Valley AutoCAD Power Us-ers, Web- : h t t p : //www.power. org (. .1).

    WELCOME AutDCAD Power Users

    A Web site by AutoCAD users for AutoCAD users, presented toA utoCA D users in Silicon alley, across the United States and

    beyond. We encourage local AutoCAD user group members to share

    . . 1. Weh- Silicon Valley AutoCAD Power Users

    Vancouver AutoCAD Users Society, Web- : h t t p : / /www. vaus . org (. .2).

    Internet Internet AutoCAD. , -

    : . cad .autocad a l t .cad.autocad. - . , Autodesk ( ) : news://adesknews .autodesk.com, Web- Autodesk.

    AutoCAD Web-, - .

    Wcb- Autodesk, h t t p : / / a u t o d e s k . c o m , AutoCAD, Autodesk. h t t p : / / a u t o d e s k . c o m / a u t o c a d Auto-CAD 2002, AutoCAD 2002, . , AutoCAD , .

    1050 VIII.

  • Vancouver

    U s e r s S o c i e t y

    Membership

    Next Meeting

    Newsletter

    Executive

    Links

    Notice Board

    V A U S ti, Qi$am/#

  • . .4. Web- CADENCE

    Web- CAD Depot (ht tp ://caddepot .com) - - , , .

    Web- CADInfo.net ( h t t p : / / c a d i n f o . n e t ) - , , , .

    Web- CADalog (AutoCAD Shareware Clearinghouse), www.cadalog.com, - AutoCAD, , AutoLISP-, .. - .

    Internet, -. . . 1 .

    > AutoCAD

    URL-

    Better Than Nothing AutoLISP h t t p : / /home.pacifier.com/~nemi

    ManuSoft http://www.manusoft.com

    Web- , AutoUSP-, , - , . -, - . ( i t . i s p i d t . i s p )

    AutoCAD, - ,

    1052 VIII.

  • . . 1

    URL-

    Moss Designs

    Mark Powell's AutoCAD &AutoUSP links

    Reini Urban's AutoCAD page

    SimpleCAD

    http://www.mossdesigns.com

    http://Web2.airmail,net/markpowl/acad.htmlhttp://xarch.tu-

    graz.ac.at/autocad/

    http://www.simplecad.com/

    University of New South Wales h t t p : / /www. f be. unsw.edu.au/Learning/AutoCAD/R2000

    VB Design

    DotSoft

    http://www.wbdesign,net/cadpages

    http://www.dotsoft.com

    , -

    Inter-net, AutoCAD

    AutoCAD, AutoUSP

    AutoUSP , Internet, - AutoCAD

    - no AutoCAD 2000

    Web- (Rendall Rath), VBA AutoCAD. -

    Web- (Terry Dotson}, - , AutoCAD, ""

    . AutoCAD 1053

  • ..;

    /Z -

    ..., ,?:-1?- .' $&"#.

    - >. .\&&*.

    ., ' ,"

    *:?..

    - ,

    , . , - AutoLlSP, - AutoCAD 2002, - . -, - - AutoCAD.

    -

    -, . , : ab!5-a.dwg, 5 -b.dwg, abl5-c.dwg .. 15 , - , , .

    , - , , 4 9 35. , 4 3 ( 34). - .

    , -, sky .g i f . - . Windows

  • Explorer (), - . ( , Name () Windows Explorer. .)

    - : R e s u l t s , Book_PDF,Reader,Links, Drawings Software.

    " " Windows

    -, . - . - , AutoCAD .

    - :

    [Application] is unable to open the [file].Please make sure the drive and file are writable.

    , Windows - , - , - -. Windows Zip- " " - . , . .

    1. Start ().2. Programs ().3. Windows Explorer ().4. Zip- .

    5. .

    6. Properties () - .

    7. Read-only ( ).8. .

    .

    Results R e s u l t s , -

    , - . , . - , - R e s u l t s . - R e s u l t s , " ", .

    . - 1055

  • Book PDF AutoCAD 2002

    - Adobe Acrobat PDF. , - Acrobat Reader Windows, Reader.

    Reader - Adobe Acrobat Reader, -

    . - .

    1. Windows Explorer Reader -.

    2. . - .

    3. , , .

    4. Windows Explorer Book PDF -.

    5. .pdf-.

    Links . -

    Links , - .

    Software Software , -

    AutoCAD 2002, . - . - www. c a d a l o g . com.

    Software . . , , - . , Chapl3, 13. AutoLISP.

    ' - Auto-J\ CAD 2002. 15 ,

    . - < ' "" ! AutoCAD.

    \ s o f t w a r e \ A u t o C A D T r i a l . - Setup.EXE.

    AutoLISP-

    ,

    1056 VIII.

  • . t x t . . - . l s p .

    - , AutoLESP, , . -, .. , , - . , -, . - , . - - .

    - . , - , . -, .

    AutoLISP , .

    1. . l s p S u p p o r t , AutoCAD .

    ^** , AutoCAD - , Tools^ Options (^ ).

    Files () "+" Support FileSearch Path ( ), Add(). Browse ().

    2. AutoCAD (load "_"), . l s p . , - ,

    3. AutoLISP .

    AutoLISP ARX - Tools^Load Application (1^). ( i n s t a l l . ) ( s e t u p . e x e ) - .

    VBA- VBA- , S u p p o r t F i l e S e a r c h PathBbi6epHTe

    Tools^Macro^Load Project. VBA- ( .dvb), Open. AutoCAD , VBA- . , , . , , . , ., ( ), Enable Macros. AutoCAD VBA- .

    VBA- Tools^Macro^Macros. VBA- Run. VBA- 37, " Visual Basic for Applications".

    . - 1057

  • .1 , -, -

    .

    |Sifa6 S 1 (

    -

    13

    21

    18

    18

    18

    16

    13

    /

    123

    2dspiral

    3dtrees

    Acadarti

    Acadsym

    Adobe AcrobatReader

    Ar1

    Archfont

    AutoCAD 2002Trial

    Br

    Brp

    Cailout

    Case

    Cnl

    Delayer

    EpdxfOOl

    Flatten

    Flatten 1

    Furn2

    Furn-symb

    Idt

    It

    Keypad

    -

    , , -

    15- AutoCAD 2002

    - - ( -)

    ,

    ; , ,

    z-

    10

    10

    14

    13

    11

    11

    18

    22

    21

    1818

    13

    13

    , - 33, - ( < @)

    -

    1058 VIII.

  • . . I

    Libeltr

    LI , ; -

    Mend

    Mmt

    Mpe-arch

    Pend

    Pipesymi Pipesym2

    Quicklsp AutoLISP

    Respace

    RasterVect

    Savea

    Sclblock

    Sclcircle

    Screwit

    Stmplot

    Treeelv!

    Treeplai

    Wb - ,

    WinZip -

    18

    11

    6

    13

    18

    10

    18

    34

    13

    26

    1

    18

    9

    18

    17

    18

    18

    18

    /

    /

    . - 1059

  • ACI, AutoCAD, 823Add Plot Style Table, , 53!Aerial View, AutoCAD, 174AutoCAD

    Internet-, 904 , 880 , 899 , 879 , 875

    AutoCAD DesignCenter, AutoCAD, 853AutoLISP, , 1AutoSnap, 104

    Batch Plot Utility, , 543BPU, , 873- , 739

    D

    DWF, , 919, 919

    Quick Dimension, 411

    s

    SLIDELIB, , 958

    VVisual LISP, 2

    w

    Web-, , 919

    , , 876, 104 , 982 , 872, 577

    , 583, 578

    FTP, , 905

    I

    i-drop, , 915

    L

    Layout Wizard, , 512

    Multiline Text Editor, , 365; 386

    OLE, , 894

    Plotter Manager, AutoCAD, 1045PowerPoint, Windows, 899

    , 619 AutoCAD, 618 , 632 SQL, 619

    , , 739 , 131; 520, AutoCAD, 550

    , 558 , 582 , 572 , 564, 568, 570

    , 570, 570, 571

    , 555, 551

    , 68; 370; 574

    1060

  • , 178, 178

    , 183, 188, 511; 520

    , 166 , 597

    , 607, 598 , 601, 602, 614

    , 894, 899 , 897

    , 877 , 132; 166 , 876 , 145 , 221

    , 204 Add, 225 , 224 AUto, 225 Box, 223 CPolygon, 225 Crossing, 223 Fence, 224 Group, 225 Last, 222 Multiple, 225 Previous, 227 Remove, 225 Single, 226 Undo, 225 Window, 222 WPolygon, 224 , 227 , 221 , 227

    , 428 , 510

    Plotter Manager, 1045, 543, 510

    , 543 , 244

    , 287, 288 , 287 , 289

    3D Objects, 739Adjust Clipping Planes, 708Aerial View, 174Attribute Definition, 578AutoCAD Batch Plot Utility, 543AutoStack Properties, 366Background, 844Bind Xrcfs, 615Block Attribute Manager, 584Block Definition, 552; 555; 566Boundary Creation, 481Boundary Hatch, 484; 488Button Editor, 941Change Dictionaries, 377Check Spelling, 376Compare Dimension Styles, 452Convert, 898Create New Dimension Style, 426Create Slide File, 955Data View, 627dbConnect Manager, 626Dimension Style Manager, 425Direction Control, 123Drafting Settings, 92; 98; 107; 191Drawing Units, 63; 121; 124Edit Attribute, 585Edit Attributes, 586Edit Text, 355Element Properties, 494Enchnced Attribute Editor, 586Enter Attributes, 583Export Data, 883Export Links, 636External Reference, 598Find, 629Geographic Location, 829Geometric Tolerance, 458Hatch Edit, 491Hatch pattern palette, 484Image, 887Image Ajust, 890Image File, 849Import WMF, 885

    1061

  • Insert, 558Insert Hyperlink, 915Label Template, 639Layer Properties Manager, 294Lights, 822Lineweight, 298Link Conversion, 651Link Manager, 635Links, 900Load Multiline Styles, 497Load or Reload Linetypes, 297; 962Material Condition, 459Materials, 837Materials Library, 835Menu Customization

    Menu Bar, 985 Menu Groups, 985

    Multiline Edit Tools, 501Multiline Properties, 496Multiline Styles, 494Named Layer Filters, 308New Distant Light, 827New Label Template, 639New Point Light, 824New Query, 642New Scene, 834New Spotlight, 826New Standard Material, 838New Text Style, 360New Toolbar, 938New View, 178; 687Object Grouping, 287Object Selection Filters, 281Options

    Printer, 1032 Profiles, 1039

    Order Group, 289Page Setup, 517Partial Open, 182Paste Special, 897; 900Plot, 538; 539Point Style, 162Properties, 276Property Settings, 324Recover Drawing File, 878Reference Edit, 603Re-initialization, 937Rename Text Style, 361Render, 820; 846Save Image, 849Save Multiline Styles, 496Saveas Options, 611

    Scenes, 834Select Color, 296; 309; 428Select Custom Arrow Block, 430Select File, 55Select Image File, 887Select Linetype, 297Select Menu File, 984Select Reference File, 598Select Script File, 950Select Shape File, 972Select Shape or Font File, 971Select Slide File, 955Shadow Options, 831Sort, 628Sun Angle Calculator, 828Symbol, 459Text Style, 359View, 178Viewpoint Presets, 680; 686; 732Viewports, 184Write Block, 555Xbind, 608Xref Manager, 598; 614

    , 76; 507 , 457

    , 152, 153

    , AutoCAD, 152

    , 63; 85; 124 , 85, 63; 121

    , 85, 85

    , 121, 121

    , 122, 122

    , 235

    , 218 , 198, AutoCAD, 823

    1062

  • , 341, 706 , 383; 1014 , 29

    3D Face, 7263D Mesh, 7383D Orbit, 699Aerial View, 174Aligned Dimension, 391Angular Dimension, 399Arc, 152AutoCAD DesignCenter, 853Back View, 683Background, 844; 846Baseline Dimension, 394; 396Bottom View, 681; 687Box, 765Chamfer, 801Circle, 148Cone, 743; 768Construction Line, 145; 147Continued Dimension, 394Copy, 370Copy Object, 209; 210Cylinder, 767Diameter Dimension, 398Dimension Edit, 415; 417Dimension Style, 425Dimension Text Edit, 416; 417Dish, 746Display UCS Dialog, 194Distance, 717; 794Dome, 745Edge, 727Ellipse, 158Erase, 204; 205Explode, 568Extend, 250; 252; 797External Reference Clip, 609Extrude, 773Fillet, 798Fog. 845Front View, 682; 687Global, 175Hatch, 484Insert Block, 558; 562; 571Interfere, 779Intersect, 778Landscape Edit, 845Landscape Library, 845

    Landscape New, 845Layers, 294; 309Left View, 681Lengthen, 253Lights, 822Line, 138Linear, 389List, 593; 902Make Block, 552; 554; 581Make Object's Layer Current, 306Mass Properties, 816Match Properties, 324Materials, 837Materials Library, 835Mirror, 235Move, 206Multiline, 499Multiline Text, 365Named Views, 178NE Isometric View, 685New, 567NW Isometric View, 685; 687Offset, 242Open, 873Ordinate Dimension, 402Pan Realtime, 167Paste, 370Point, 162Polygon, 142Polyline, 464Print Preview, 543Properties, 314; 315; 317; 355; 470; 477; 580; 664Pyramid, 742Quick Leader, 405; 409Radius Dimension, 397Rectangle, 141; 659Redo, 74Redraw All, 133Render, 820Render Preferences, 846Revolve, 775Revolved Surface, 752Right View, 682; 687Rotate, 214; 215Ruled Surface, 757Save, 47Scale, 217Scenes, 834SE Isometric View, 684Section, 782Setup Drawing, 722Setup Profile, 722Setup View, 720

    1063

  • Slice, 783Snap From, 116; 466; 500Sphere, 744; 767Spline, 472Statistics, 848Stretch. 256Subtract, 777; 780SW Isometric View, 683; 687Tabulated Surface, 755Top View, 680; 687Torus, 770Trim, 248UCS Previous, 194Undo, 72; 74Union, 777View, 178Wedge, 741; 769Zoom All. 170Zoom Center, 170Zoom Dynamic, 170; 563Zoom Extents. 171; 558Zoom In, !70; 175Zoom Out, 86; 170; 175Zoom Previous, 170; 171Zoom Scale, 170Zoom Window, 189; 473; 477Zoom Window, 170

    , AutoCAD, 160 AutoCAD

    3DARRAY. 7883DPOLY, 664AI_CONE, 743Ar_PYRAMID, 742AI_ WEDGE, 741ALIGN, 244; 794ARC, 152ARRAY, 236; 564; 788ATTDEF, 578ATTREDEF, 588AUDIT, 877BASE, 556; 581BHATCH, 484BMAKE, 552BOUNDARY, 335; 480; 490BREAK, 259; 468CAL, 341CAMERA, 707CHAMFER, 261CHANGE, 218; 270CIRCLE, 71; 148; 664CLOSE, 952COMPILE. 971

    COPY, 209; 215; 238COPYCL1P, 574CUTCLIP, 574dbCONNECT, 620DDEDIT, 355; 369; 418; 580; 583DDVIEW, 178DDVPOINT, 680; 686DELAY, 956DIMALIGNED,391DIMANGULAR, 400DIMEDIT, 415DIMLINEAR, 386DIMOVERRIDE, 455DIMSTYLE,454DIMTEDIT,416DIST, 334DIVIDE, 338DONUT, 160DOUGHNUT, 160DRAWORDER, 893DTEXT, 348; 981DVIEW, 712EDGE, 727EDGESURF, 759ELEV, 665ELLIPSE, 158; 767ELLIPSE Isocirclc, 199ERASE, 204; 553EXPLODE, 568; 802EXTEND, 249; 479; 795EXTRUDE, 726; 772FILL, 160FILLET, 265; 798FIND, 375HATCHEDIT, 722HIDE, 665ID, 191;334IMAGEDISPLAY, 890IMAGEQUALITY, 891INSERT, 558INSERTOBJ, 894; 895; 900INTERFERE, 778INTERSECT, 480; 778ISOPLANE, !98LEADER, 349LENGTHEN, 253LINE, 138; 668; 1003LINETYPE,961LIST,332; 334; 886LOAD, 972MASSPROP,337;815MEASURE, 338MENU, 984

    1064

  • AutoCADMENULOAD, 985MrNSERT, 564MIRROR, 235; 273; 374MIRROR3D, 787MLEDIT,501ML1NE, 499MOVE, 206; 523MSLIDE, 955MTEXT, 365; 524MULTIPLE, 71MVSETUP, 135; 522OFFSET, 242OOPS, 74; 206; 553OSKAP, 102PAN, 166; 715PAN Realtime, 678PASTECLIP, 574PASTESPEC, 897

    PEDIT, 467; 664; 732; 738; 751; 945PFACE, 732PLAN, 680; 692PLINE, 464; 664; 1003PLINEGEN, 465POINT, 162POLYGON, 144; 668PSFILL,931PSOUT, 931PURGE, 310; 553QDIM,419QLEADER, 349; 405QTEXT, 372; 571RAY, 146RECOVER, 877RECTANG, 141; 144REDO, 73REDRAW, 163; 166REGEN, 166; 374; 528REGION, 479; 668; 725; 772REINIT, 937RESUME, 956REVOLVE, 775REVSURF,751;775ROTATE, 741; 791ROTATE3D, 791RS,349RSCRIPT, 956SCALE. 217SECTION, 782SELECT, 227SETVAR, 328SHADEMODE, 695SHAPE, 964

    SHAPE. 972SKETCH, 505SLICE, 782; 783SNAP, 97SOLDRAW, 722SOLID, 493; 668; 725SOLIDEDIT, 804SOLPROF, 722SOLVIEW, 720SPELL, 376SPLINE, 471SPLINEDIT.474STATUS, 327

    STRETCH, 256; 270; 421; 523STYLE, 352; 359SUBTRACT, 480; 777TABLET, 507; 1011TABSURF, 754; 772TEXT, 354; 524TIME, 330TOLERANCE, 457TRACE, 504TRANSPARENCY, 891TRIM, 221; 246; 479; 795U, 72UNDO, 72; 554UNION, 480; 776; 783VLIDE, 2VPOINT, 680; 688VSLIDE, 956WBLOCK, 555; 557XBIND, 608XCLIP, 609XLINE, 145XPLODE, 568ZOOM, 169; 715ZOOM All, 126ZOOM Extents, 145; 220ZOOM Previous, 211; 678ZOOM Realtime, 678ZOOM Window, 210; 220; 232, 67 , 78 , 71 , 72, 70, 68, 988, 75

    DrawOBlock1^Define Attributes, 578Draw=>Boundary, 481DrawODonut, 161

    1065

  • Draw* Points Divide, 338Draw * Points Measure, 338Draw* Ray, 146Draw*Solids, 763Draw*Surfaces*3D Surfaces, 739Draw*Text* Single Line Text, 348Edit*OLE Links, 900Edit*Paste Special, 895File*Close, 47File*Drawing Utilities Recover, 878File*Exit, 48File*Export, 883File*Plot Style Manager, 531File*Plotter Manager, 541; 1045File*SaveAs, 611FileOUpdate, 894Format* Drawing Limits, 126Format*Lineweights, 299Format*Multiline Style, 494Formats Point Style, 162; 338; 715Format*Text Style, 359Format* Units, 121; 122Insert*OLE Object, 894Inserts Raster Image, 887Modify*3D Operation^3D Array, 788Modify*3D Operation*Align, 795Modify*3D Operation^Mirror 3D, 787Modify*3D Operation* Rotate 3D, 793Modify*3D Operations* Align, 244Modify*Clip*Xref, 609Modify^ Objects Hatch, 491Modify^ Objects Imaged Adjust, 890Modify^ Objects Imaged Frame, 891Modify* Objects Image Quality, 891Modify*Object^Image1^Transparency, 891Modify*Object*Multiline, 501Modify*Object*Spline, 475Modify*Object*Text*Edit, 369; 418Modify* Polyline, 467Modify*Text, 355; 580Projection*Parallel, 707Projection*Perspective, 707Recent Commands, 68Start*Programs*AutoCAD 2002*

    Batch Plot Utility, 543Too i s* AutoCAD DesignCenter, 853Tools*AutoLISP*Visual LISP Editor, 2Tools*Customize*Menus, 946Tools*Display Image*Save, 849Tools*Display Order, 893Tools *Drafting Settings, 92; 107; 134; 190;

    199;215; 382

    Tools*Inquiry*Area, 334Tools*Inquiry*Distance, 333Tools*Inquiry*ID Point, 333Tools*Inquiry*List, 886Tools*Inquiry*Set Variable, 330Tools*Inquiry*Status, 327Tools*Inquiry*Time, 330Tools*MoveUCS, 193; 402Tools*Named UCS, 193TooIs*NewUCS, 192; 672Tools*New UCS*3 Point, 730Tools*Options, 983Tools*Orthographic UCS, 193Tools*Spelling, 376Tools*Tablet, 507Tools *Tablet* Calibrate, 508TooIs*Wizards*Add Plot Style Table, 531TooIs*UCS*Save, 198View*3D Views, 679View*3D Views* Viewpoint Presets, 686View*Aerial View, 174View*Display*UCS, 195View* Display* UCS Icon*Origin, 402View*Named Views, 178; 687View*Pan*Point, 167View*Redraw, 166View* Viewports, 184; 520View*Viewports*l Viewport, 186View* Viewports* Join, 186View*Viewports*New Viewports, 185View*Zoom*In, 75View*Zoom*Out, 75

    , 67, 688 , 104 , 102

    , 298, 169, 167, 269

    , 42; 66

    , 88

    , 86 , 86, 87

    , 95 , 209, AutoCAD, 148

    , 97

    1066

  • , 50; 125, AutoCAD, 146

    , 988 , 236

    , 238, 237

    , 128 , 128 , 128

    , 216

    Draw, 998Format, 988View, 61, 990

    , 192, AutoCAD, 142, 493

    , 493, 500, 494

    , 221

    , 187 , 186 , 186 , 183, 186, 184 , 187

    , 183

    , 171, AutoCAD, 478; 480 , 102 AutoCAD Today, 862, 482, , 109 , 507

    , 948, 950, 949

    , 423D Orbit, 705Character, 367Dimension, 67; 383Draw, 65Inquiry, 717Modify, 65; 235Object Properties, 294; 300; 328; 524Object Snap, 106Object Snap, 102Reference, 598Render, 820Soiids, 720; 763Solids Editing, 777; 804Surfaces, 724View, 679Zoom, 170, 938

    , 166 , 167 , 167

    , 323 , 206 , 166 , 994

    , 751; 752, 759, 754, 757

    , 214 , 990 , 246 , 873, 463

    , 467, 464, 663

    , 92 , 91 , 192

    , 192, 194, 193

    , 55 , 868 , 511, AutoCAD, 145

    1067

  • , 85

    Windows-, 935 AutoCAD, 935

    , 425 , 425 , 436, 425,430

    , 444, 446 , 442

    , 525, 449, 402, 383 , 405 , 396, 380 , 393,390,388 , 393; 394 , 380, 413, 398

    , 337 , 338 , 338

    , 259, 695

    , 887 , 890, 888, 889

    , 256 , 165

    ORTHO.91 , 107 , , 190 , 97

    , 878, 268

    , 268 , 269 , 662

    , 293; 323 , 874 , 223 AutoCAD

    ATTDIA, 579CELTSCALE, 321DELOBJ, 479; 772; 777DIMSTYLE, 454DISPSILH, 764Edge, 248; 251FACETRATIO, 696FACETRES, 764; 1030FILEDIA, 949FILL, 492FILLMODE, 1030HIDEPRECISION, 696HYPERLINKBASE,917INDEXCTL,612ISOLINES, 764; 1030LTSCALE, 528LWDEFAULT, 1037MIRRTEXT, 374OSMODE, 1003PLINEGEN, 465; 468Projection, 248; 251PTLTSCALE, 528SDI, 952SKPOLY, 505; 506SOLIDCHECK, 805SPLFRAME, 728SPLINESEGS, 1030SURFTAB 1,752SURFTAB2, 752SURFTYPE, 739UCSFOLLOW, 693UCSORTHO, 680VIEWRES, 764; 1030VISRETAIN, 608XCLIPFRAME,610XFADECTL, 604XLOADCTL, 1032XREFCTL.616 , 328

    , 958, 955, 955,956

    , 292; 293, 294; 302/, 293; 302

    1068

  • ,292; 293 , 294; 302/, 293; 302 , 300, 307

    , 309, 310, 308, 310 , 310 , 308

    , 293, 294

    , 297 , 298 , 296 , 295

    , 865 , 265

    Color Control, 313Layer Control, 300Linetype Control, 315

    , 45 , 327, 471

    , 472, 474

    , 78

    , 330 , 332 , 334 , 333 , 328 , 332

    , 528 , 204 , 41

    , 95 GRID, 100 ORTHO, 91 OSNAP, 107 SNAP, 98

    , 772, 777 , 815, 776 , 764

    , 778 , 782, 785

    , 794 , 787, 791 , 788 , 798. 800

    , 775 , 764

    , 348, 369 , 524 , 350, 350, 370, 372, 365, 348 , 369 , 376 , 372, 355 , 377 , 359

    , 363 , 360 , 361 , 361 , 359 /, 360 , 361

    , 349

    , 373 AutoCAD, 373 , 373

    , 351 , 352

    , 352 , 315

    ByLayer, 315 , 316 , 315 , 316, 318 , 960

    , 739 , 752, 741, 743

    1069

  • , 745, 740, 742, 747, 744, 746, 746

    , 764, 818

    , 821, 826, 823, 824, 827

    , 834 , 818 , 849

    , 349, AutoCAD, 161 , 688 , AutoCAD, 725

    , 732 , 737

    3D orbit, , 698 , 692 , 711, 711, 658

    , 658 , 661 , 678, 815 , 654, 711, 724

    , 754, 759, 757 , 751, 739

    , 670, 662 , 655

    , 656 , 656, 657, 657

    , 763 , 679 , 712 , 688

    , 665 , 664

    , 720

    , 795, 802, 795

    , 253 , 860 , 249

    Acad -Named Plot Styles.dwt, 69Acad -Named Plot Styles.dwt, 71acad.dcl, 931acad. dwt, 602acad.fmp, 931acad.lin, 298; 931; 960acad.lsp, 931acad.mln,497;498;931acad.mnc, 983acad.mnl,931;983;987acad.mnr, 983acad.mns, 931; 983acad.mnu, 931; 946; 982; 991acad.pat, 483; 931acad.pc3, 931acad.pgp, 383; 930; 931acad.psf, 931acad.rx, 931acad.slb, 931acad.unt, 931acad2002.cfg, 931Mrotate.lsp, 214mtextmap.ini, 931render.mli, 836sample.cus, 378savea.lsp, 872Sclblock.lsp, 572simplex.shx, 373\Sofhvare\Chap08\Isomak, 198\Sonware\Chapl3\Archfont, 360\Software\Chapl3\Respace, 349\support\acad.fmp, 373TrueType.dwg, 360txt.shx, 373 , 885

    1070

  • AutoCAD, 983 AutoCAD, 930, 879

    .3DS.881

    .$, 876; 878

    .bak, 878

    .BMP, 841; 845; 881; 887

    ., 543

    .cal, 887

    .cg4, 887

    .ctb, 529

    .cus,931

    .dib, 887

    .die, 378

    .dwg, 878

    .DXF, 882

    .EPS, 881

    .fas, 4

    .flc, 887

    .flt. 887

    .GIF, 845; 887,gp4, 887jpeg, 887JPG, 845; 887Jin, 298; 960.Isp, 4.mil, 887.mli, 836.min, 496.mnc, 983.mnl, 983.mnr, 983.mns, 983.mnu, 983.pat, 483; 966.pc2, 543-pc3, 1045.pep, 543.pet, 887.PCX, 845; 887png, 887.rle. 887.rst, 887.rtf, 368.sat, 881.scr, 931; 949.shp, 360; 931; 971.shx, 360; 931; 962.sib, 958. s l d , 955

    .stb, 529

    .STL, 881

    .TGA, 841; 845; 887

    .TIF, 841; 845; 887

    .txt, 368

    .vlx, 4

    .WMF, 884

    .xlg, 616 , 881

    , , 904, 261, AutoCAD, 493 , 279

    , 283, 285, 284, 284, 281

    , AutoCAD, 971 , 972 , 971

    , 313

    ByLayer, 313, , 313, 296, , 315, 297

    , 632 , 49, , 979, 131, 482

    , 486, 484, 488, 491 , 965

    , 242 , 61 , , 905, AutoCAD, 156 , AutoCAD, 157 , AutoCAD, 505

    1071

  • -

    AutoCAD 2002.

    .. . .

    . .. , ..

    "".]01509, , . , . 43, . 1.

    . . 090230 23.06.99 .

    24.04.2003. 70X100/16. Times. .. . . 86,43. .-. . 69,44.. 5000 . 2840.

    " " ,

    .197110, -, ., 15.

    AutoCAD 2002 I. AUTOCAD 1. 2. 3. AutoCAD 4. 5.

    II. 6. 7. 8. 9. : 10. 11. , , 12. 13. 14. 15. 16. 17.

    III. 18. 19. 20.

    IV. 21. 22. 23. 24. 25.

    V. 26. 27. 28. AutoCAD Internet

    VI. AUTOCAD 29. 30. - 31. 32. 33.

    VII. AUTOCAD VIII. . AutoCAD . AutoCAD . -