Znaczenie twarogu w ywieniu czowieka

  • Published on

  • View

  • Download


  • 115Siemianowski K, Szpendowski J. Znaczenie twarogu w ywieniu czowieka

    Znaczenie twarogu w ywieniu czowiekaImportance of tvorog in human nutrition

    Krzysztof Siemianowski, Jerzy Szpendowski

    Katedra Mleczarstwa i Zarzdzania Jakoci, Wydzia Nauki o ywnoci, Uniwersytet Warmisko-Mazurski w Olsztynie

    Tvorog is relatively low-energy value product with a high content of valuable and easily digestible protein. It also contains a fraction of easily digestible milk fat and lactose as well as vitamins and minerals. These unique nutritional values predispose cottage cheese to be used in daily nutrition of both healthy people and those suffering from various pathological and non-pathological states, which require an appropriate diet modification. We should strive for increasing the consumer interest in cottage cheese by popularizing knowledge about its high nutritional value.

    Key words: tvorog, nutritional value, human nutrition

    Twarg to produkt o stosunkowo maej wartoci energetycznej i duej zawartoci penowartociowego i atwo trawionego biaka. Zwiera rwnie pewne iloci lekkostrawnego tuszczu mlekowego, laktozy oraz witaminy i sole mineralne. Unikalne walory odywcze predysponuj twarg do stosowania w codziennym ywieniu ludzi zdrowych oraz znajdujcych si w rnych stanach patologicznych i niepatologicznych organizmu, ktre wymuszaj odpowiedn modyfikacj diety. Naley dy do zwikszania zainteresowania konsumentw twarogiem przez upowszechnianie wiedzy na temat jego wysokiej wartoci ywieniowej.

    Sowa kluczowe: twarg, warto odywcza, ywienie czowieka

    Adres do korespondencji / Address for correspondence

    mgr in. Krzysztof SiemianowskiKatedra Mleczarstwa i Zarzdzania Jakoci, Wydzia Nauki o ywnoci, Uniwersytet Warmisko-Mazurski w Olsztynieul. Michaa Oczapowskiego 7, 10-719 Olsztyntel. 89 523 47 32, fax 89 523 34 02e-mail: krzysztof.siemianowski@uwm.edu.pl

    Probl Hig Epidemiol 2014, 95(1): 115-119


    Nadesano: 14.01.2014Zakwalifikowano do druku: 05.02.2014


    Niedojrzewajce sery twarogoweto liczna izr-nicowanagrupaproduktwmleczarskichdostpnychpowszechnienarynkukrajowym.Wanemiejscewtejgrupieasortymentowejzajmujetwarg,nazywanyrw-nie,,serembiaym,ktregospoycieuwarunkowanejest tradycj, przyzwyczajeniami ywieniowymi orazaspektamiekonomicznymi[1].Twargotrzymujesiwwynikuodpowiedniejobrbkiskrzepumlekaodtusz-czonegolubnormalizowanegopodwzgldemzawartocituszczu, rzadziej malanki lub mieszaniny malankiimleka, skoagulowanegonaskutekukwaszeniaprzezkulturybakterii fermentacjimlekowejdokwasowociczynnej odpowiadajcej punktowi izoelektrycznemubiaekfrakcjikazeinowej(pH4,5-4,6)[2-4].Obrbkaskrzepu polega na krojeniu, mieszaniu i ogrzewaniu,anastpnie separacji powstaego ziarna twarogowegoodwydzielonej serwatki.Oddzielonamasatwarogowapoddawanajestprasowaniuiformowaniuorazpakowa-niu.Whandlutwargprasowanydostpnyjestwpostaciproduktwoksztaciebloku,klina,okrgymlubinnym.Tradycyjnytwargprasowanyzewzgldunazawartotuszczudzielisinachudy,ptustyitusty[3-6].

    Cel pracy

    Scharakteryzowanie wartoci odywczej i przy-datnocitwaroguwywieniuczowieka.

    Warto odywcza twarogu


    Tabela I. Skad chemiczny oraz warto energetyczna rynkowych twarogw wg deklaracji producenta Table I. Chemical composition and energetic value of commercial tvorog varieties according to the manufacturers declarations


    [g/100 g]Wglowodany

    [g/100 g]Tuszcz

    [g/100 g]

    Warto energetyczna [kcal/100 g]

    Chudy 19,8 3,5 0,5 98

    Ptusty 16,7 3,4 4,0 116

    Tusty 15,3 3,6 9,0 156

    Biaka ywnoci stanowi dla czowieka przedewszystkim rdo aminokwasw wykorzystywanych

    Probl Hig Epidemiol 2014, 95(1): 115-119

  • 116 Probl Hig Epidemiol 2014, 95(1): 115-119

    wustrojudosyntezybiaekstrukturalnychorazbiaekipeptydw biologicznie czynnych, m.in. enzymwihormonw.Wduymstopniuowykorzystaniuspoy-tegobiakaworganizmiedecydujejegokompozycjaami-nokwasowa,acilejzawartoposzczeglnychamino-kwaswegzogennych.Biako,wktrymwystpujezna-czcyniedobrktregozaminokwaswegzogennychwykorzystywanejestgwniejakordoenergii.Biakamlekazaliczanesdobiaekpenowartociowych,awictakich,ktrychskadaminokwasowypozwalananiemalcakowiteichwykorzystanie,jakordaaminokwaswdosyntezybiaekustrojowych[7,8].Udziabiakawskadzie suchejmasy twaroguchudegowynosiok.80%,ptustegook.67%,tustegook.53%.Wtwaroguprodukowanymmetodtradycyjnniemalwycznymskadnikiembiakowymjestkazeina,gdyzdecydowanawikszobiaekfrakcjiserwatkowej,stanowicychok.20%ogubiaekmleka,pojejwytrceniuwpunkcieizoelektrycznymiprzeprowadzeniuobrbkiskrzepu,pozostajewroztworze i jest traconaz serwatk[9].Poniewa biaka serwatkowe charakteryzuje bardzowysokawartoodywcza,wyszaodkazeiny[9,10],dlategoduympostpemwtechnologii twarogubyoopracowanieiwdroeniemetodpozwalajcychnaichwczeniedomasyproduktu.Takiemoliwocidajeprodukcjatwarogumetodwapniowo-termicznorazmetodzwykorzystaniemtransglutaminazy[11,12].Wtradycyjnej metodzie produkcji twarogu biakoogemsurowcawykorzystywanejestwok.75%.Za-stosowanie metody wapniowo-termicznej pozwalanazwikszeniestopniawykorzystaniabiakaogemsurowcawtwarogudook.90%[11].Wczeniebiaekserwatkowychdotwaroguwiesizeznacznymzwik-szeniemwartociodywczejjegobiaka(tab.II).Biakotwaroguprodukowanegometodwapniowo-termicznwporwnaniuzbiakiemtwaroguotrzymanegometo-dtradycyjncharakteryzujesiwikszzawartociwszystkichaminokwaswegzogennychorazwyraniewikszymiwartociamiwskanikaaminokwasuograni-czajcegoCS(Met+Cys77,3wobec71,1)izintegro-wanegowskanikaaminokwaswegzogennychEAAI(89,9wobec81,9). Wysok warto odywcz biaka twarogu po-twierdzaj wartoci wskanikw wyznaczonychwoparciuowynikibadaywieniowychprowadzo-nychzwykorzystaniemzwierzt.Wartociwskanikawykorzystaniabiakanetto(NPU)orazwydajnociwzrostowej(PER)dlabiakatwaroguprodukowanegometodtradycyjnwynosiyodpowiednio60,1i2,55;natomiasttwaroguprodukowanegometodwapnio-wo-termiczn61,5i2,51.Wbadaniachtychwykaza-norwniewyranywpywrodzajutuszczuwdiecienawykorzystaniespoywanegobiaka.Pozastpieniuoleju sojowego masem wartoci wskanikw NPUiPERwprzypadkubiaka twaroguprodukowanegometodtradycyjnwynosiyodpowiednio70,7i2,52;

    natomiasttwaroguprodukowanegometodwapnio-wo-termiczn82,8i2,68[13].Dlaporwnaniawar-tociwskanikaNPUorazPERwynoszodpowiedniodla biaka: woowiny 64,0% i 2,4; tuszki kurczaka65,0%i2,4;soi66,0%i2,1;pszenicy55,0%i1,1;fasoli48,0%i1,7;ziemniakw53,0%i1,2;elatyny24,0%i0,3[14].Strawnorzeczywistabiakatwa-rogukwasowegomoesiga96-97%ijestznaczniewysza od strawnoci rzeczywistej biaka pynnegomleka wieego, wynoszcej rednio 86%. Wysokastrawnobiakatwaroguwynikam.in.zjegoskoagu-lowanejpostaciorazczciowejhydrolizy,cozwikszajego podatno na dziaanie enzymw trawiennych[15].Biakamlekastanowibogaterdolizyny,kt-rajestaminokwasemograniczajcymwbiakuzb.Spoywanie twarogu jednoczenie np. zpieczywemsprawia, e deficytowe pod wzgldem lizyny biakopszenicyzostajeuzupenioneotenaminokwasistajesibiakiempenowartociowym,dzikiczemumoeby lepiejwykorzystaneprzezorganizmdosyntezybiaekustrojowych[9,14]. Tuszcz mlekowy to wany skadnik twarogu,decydujcyojegowartocienergetycznej.Zawartotuszczuwtwaroguchudymjestznikoma(do0,5%)iniemawikszegowpywunajegowartoenerge-tyczna,podczasgdywtwaroguptustymok.30%,atustymok.50%wartocienergetycznejpochodziztuszczu(tab.I).Tuszczepoywieniastanowidlaorganizmunietylkoobfiterdoenergii,dostarczajrwnieniezbdnychskadnikwdobudowypodsta-wowych struktur i funkcjonowania kadej komrkioraz s prekursorem i nonikiem wielu zwizkwaktywnychbiologiczniewustroju[10,16].Tuszczmlekowypodwzgldemkompozycjikwaswtuszczo-wych (KT) zaliczany jest do najbardziej zoonych

    Tabela II. Zawarto aminokwasw egzogennych oraz warto odywcza biaka twarogu produkowanego metoda tradycyjn i wapniowo-termiczn [11]Table II. Content of essential amino acids and nutritional value of protein in tvorog varieties produced with traditional and calcium-thermal methods [11]

    Aminokwasy[g/16 g N]


    produkowany metod tradycyjn

    produkowany metod wapniowo-termiczn

    Izoleucyna 4,89 5,39

    Leucyna 9,49 10,60

    Lizyna 7,82 8,51

    Metionina + cysteina 3,20 3,48

    Fenyloalanina + tyrozyna 12,12 12,87

    Treonina 4,96 5,05

    Tryptofan 1,45 1,91

    Walina 5,94 6,49

    Suma aminokwasw egzogennych

    49,87 54,30

    Wskanik aminokwasu ograniczajcego (CS)

    71,1metionina + cysteina

    77,3metionina +cysteina

    Wskanik aminokwasw egzogennych (EAAI)

    81,9 89,9

  • 117Siemianowski K, Szpendowski J. Znaczenie twarogu w ywieniu czowieka

    tuszczw jadalnych, gdy zidentyfikowano w nimponad400rnychKT[17,18].Woglnymska-dzieKTtuszczumlekowegoKTnasyconestanowi61,75-74,23%;KTjednonienasycone21,53-30,93%;KTwielonienasycone2,36-5,04%.Krtkoirednio-acuchoweKTnasyconeoparzystejliczbieatomwwgla(C4:0-C14:0)stanowisumarycznie19,91-27,20%KTtuszczumlekowego.SpordKTjednonienasyco-nychwtuszczumlekowymdominujekwasoleinowy,stanowicy 17,21-24,16% ogu wystpujcychKT [19]. KT wielonienasycone reprezentowane swtuszczumlekowymgwnieprzezkwas linolowy(n-6)orazlinolenowy(n-3),zaliczanedoniezbd-nychnienasyconychkwaswtuszczowych(NNKT).ProporcjazawartociKTzrodzinn-6in-3wtuszczumlekowym jest optymalna dla potrzeb organizmuczowieka, co gwarantuje, e wymienione KT mogpeniwewaciwysposbswrolbiologiczn[18,20].PrawidowystosunekzawartociKTzrodzinn-6in-3wdieciepowinienwynosiok.4-5:1[21].Specy-ficznyskadkwaswtuszczowychorazwystpowaniew postaci rozproszonych kuleczek o odpowiedniejbudowie sprawi, e spord tuszczw poywieniatuszczmlekowywykazujenajwyszstrawno,wy-raan zarwno szybkoci, jak i wspczynnikiemwchaniania,wynoszc97-99%[10,18]. Wglowodany,oboktuszczu,stanowidlaorga-nizmupodstawowerdoenergii.Zawartowglo-wodanwwtwaroguwynosi3,4-3,6%.Udziaenergiipochodzcej z wglowodanw w oglnej wartoenergetycznej twarogunieprzekracza15%(tab.I).Gwnym wglowodanem obecnym w twarogu jestlaktoza[22],ktrajestwchanianaiwykorzystywanaprzezorganizmpouprzedniejhydroliziedoglukozyigalaktozy[10]. Tradycyjny twargzawieraok.0,8-0,9%skad-nikwmineralnychogemwyraanych jakopopi,ktregogwnskadowswap i fosfor(ok.40%popiou).Zawartowapniaifosforuwtwaroguotrzy-mywanym metod tradycyjn wynosi odpowiedniowprodukciechudym(75,3%wody)96i240mg/100g;ptustym(72,1%wody)94i227mg/100g;tustym(67,9%wody)88i216mg/100g[22].Efektywnowykorzystaniaspoytegowapniaprzezorganizmzaleym.in.odpodaybiakaifosforuwdiecieorazwitaminyD.Wchanianiewapniaorazjegohomeostazawustro-juwarunkowana jestpokryciemzapotrzebowanianawitaminD.Zaoptymalnystosunekilocispoytegowapniadofosforuwdiecieuznajesi1,3:1,cowynikazmolowegostosunku1:1midzytymimakroelemen-tami[23-25].Niekorzystnywpywbiakanabilanswapniowyujawniasi,gdystosunekzawartociwapniadobiakawdiecie(mgCa/1gbiaka)jestniszyod20 [9]. W twarogu stosunek zawartoci wapnia dofosforuwynosi0,4:1,adobiakaok.5iztegopowodu

    produkttenspoywanysamodzielnieuznawanyjestzazerdowapnia.Podwzgldemzawartociwapnia,jegostosunkudofosforu ibiakaznaczniegorzejodtwaroguwypadajjednakproduktymisne.Produktypochodzenia rolinnego w wikszoci przypadkwcharakteryzuj si nadmiarem fosforu w stosunkudozawartegowapnia, jak rwnieobecnociwieluskadnikw utrudniajcych przyswajalno wapnia,m.in. nierozpuszczalnych frakcji bonnika, kwasuszczawiowegoifitynowego[9,22-26].WprzypadkutwarogudoczynnikwkorzystnychzpunktuwidzeniabiodostpnociwapnianaleyzaliczyniskiepH,obec-nolaktozyorazaminokwaswzasadowych[24,25].Twargstanowilepszerdowapniawporwnaniuzproduktami misnymi i pochodzenia rolinnego,dlategoregularnejegospoywaniepoczonezdobrymzbilansowaniemdietypodwzgldempoday fosforusprawia,eprodukttenmoewnosiistotneilociwap-niazpunktuwidzeniazapotrzebowanianatenskadnik[22].Porcja100g twaroguzawieraok.1mgcynkuodznaczajcego si wysok biodostpnoci zracjiobecnociznacznychilocipenowartociowegobiaka[22,24].Wmniejszychilociachwtwaroguznajdujsim.in.sd,potas,magnez,jod.Twargstanowido-brerdowitaminyB2iB12.Spoycie100gtwaroguptustego pokrywa dzienne zalecane spoycie dladorosejosobynawitaminB2wok.37%,anawitaminB12wok.33%.Porcja100gtwarogupokrywarwniewok.7%dziennezalecanespoyciedladorosejosobyna foliany[22,27].Twargwmniejszych ilociachzawierarwniewitaminyB1,B6,PP,A,DiE[22].

    Twarg w ywieniu czowieka

    Jednymznajwaniejszychczynnikwdecyduj-cychozdrowiuczowiekajestsposbodywiania.Dlautrzymaniaorganizmuwstaniezdrowiakoniecznejestwaciwezbilansowaniecodziennejdietypodwzgldemilocidostarczanejenergiiorazposzczeglnychskad-nikwodywczychwodniesieniudoindywidualnegozapotrzebowania iwsposbzgodnyzzasadamipro-filaktykichorbywieniowozalenych[28].Twargnaleytraktowaprzedewszystkimjakostosunkowomaoenergetyczne, obfite rdo atwostrawnegoipenowartociowegobiaka[11,13,15].Powszechnieuwaasi,eczowiekzdrowy,oprzecitnejaktyw-noci fizycznej, powinien spoywa biako wilociok.1g/kgm.c./dob,przyczympoowtejwartocipowinnostanowipenowartociowebiakopochodze-niazwierzcego[29].Regularnespoywanietwaroguwumiarkowanychilociach(ok.50-75g/dzie)przezdzieci,modzieidorosychstanowicenneuzupenie-nie ich diety wpenowartociowe biako zwierzce.Bardzoczstostanfizjologicznyorganizmuczowiekawymuszamodyfikacjdietywkierunkuzwikszeniailoci spoywanegobiaka,comona atwoosign

  • 118 Probl Hig Epidemiol 2014, 95(1): 115-119

    poprzezwczeniedojadospisutwarogu.Przykademniepatologicznego stanu organizmu wymagajcegozwikszenia ilocibiaawdiecie jestcia i laktacja[8]orazuprawianieniektrychdyscyplinsportu[29].Stanypatologiczneorganizmu,takiejaknp.urazy,stanypooperacyjne,oparzenia,infekcje,nasilajrozpadbia-ekustrojowych,przezcowymagajzwikszeniapodaypenowartociowegoiatwoprzyswajalnegobiakapo-karmowego[7,8],ktregoczciowymrdemmoebytwarg,jelistanchoregopozwalanarealizowanieodywianiadrogdoustn.Wywieniuchorychnanowotworykoniecznejestzwikszenieilociprzyjmo-wanegobiaka,gdyaminokwasywichorganizmachwykorzystywanesnie tylkodostaejfizjologicznejodnowy biaek ustrojowych, ale take dla syntezybiaektkankinowotworowej ibiaekpatologicznych,takichjakbiakaostrejfazy.Zbytniskapodapeno-wartociowegobiakawdieciechorychnanowotworysprzyjapostpujcemuwyniszczaniuorganizmu[30].Biakommleka,przedewszystkimfrakcjiserwatkowej,przypisywaneswaciwociantymutagenneiantykan-cerogenne.Efekttentumaczonyjestobecnociwnichaminokwaswsiarkowych,ktrychzwikszonapodaintensyfikujeworganizmiesyntezglutationu[9,31].Sumaryczna zawarto aminokwasw siarkowychwtwaroguotrzymywanymmetodtradycyjnwynosi3,20g/100gbiaka,natomiastwtwaroguprodukowa-nymmetodwapniowo-termiczn3,48g/100gbiaka[11].Twargmoewchodziwskaddietzalecanychosobomzchorobamiukadukrenia.Zarwnotuszczmlekowy,ktregonajwicejspordtwarogwzawieratwargtustyok.9g/100gproduktu, jakrwniebiakozwierzcewdobrzezbilansowanejdiecieniestanowi zagroenia miadyc. Zwikszenie ilocispoywanego biaka moe skutkowa dziaajcympromiadycowoutrzymywaniemsipodwyszonegosteniahomocysteinywekrwi.Stan tenwystpujejednak w przypadku niedoborw w diecie niezbd-nych w przemianach metioniny witamin kwasufoliowego,B6iB12.Szczeglnienaraeninaniedoborywymienionychwitamin,itymsamympromiadycowedziaaniepodwyszonegosteniahomocysteinywekrwi, s wegetarianie [32, 33]. Regularne spoycietwarogu moe mie due znaczenie w profilaktyceiterapiiywieniowejnadcinieniattniczego.Wynikatozmaejzawartocisoduwtwarogu(ok.40-44mgNa/100gproduktu)[22]orazfaktu,ebiakamlekastanowipotencjalniebogaterdopeptydwoak-tywnociprzeciwnadcinieniowej,ktrychdziaaniepolega gwnie na inhibicji enzymu konwertujcegoangiotensyn[34,35].Podczastrawieniabiaekmlekawprzewodziepokarmowymmogbyuwalnianerw-niepeptydyoaktywnocim.in.przeciwzakrzepowej,antybakteryjnej, immunomodulacyjnejiantyoksyda-cyjnej[34].Tryptofanpochodzcyzbiaka twarogumoebywykorzystywanydosyntezyserotoniny,ktra

    peniwanrolwregulacjiwielufunkcjiorganizmu,m.in.nastroju,snu,aknienia[36].Twargmoebyskadnikiem diet wywieniu ludzi ze schorzeniamiukadu pokarmowego, wchorobach wtroby, nerekicukrzycy[10].Twargptustyitusty,zewzgldunapenowartociowe i atwostrawnebiako[13,15]oraz terapeutyczne dziaanie na nabonek jelitowykrtkoacuchowychKTobecnychwlekkostrawnymtuszczu mlekowym [18, 20], powinien wchodziwskad diety ludzi tolerujcych skadniki mleka zeschorzeniamizapalnymijelit.Naleyrwniezazna-czy,etuszczmlekowy,chowtwaroguniewystpujewduychilociach,zawieraliczneskadnikiodziaaniuantymiadycowymiantynowotworowym.Stonie-ktre kwasy tuszczowe, wtym skoniugowany kwaslinolowy(CLA),fosfolipidy,koenzymQ10orazwitami-nyA,D3iE.Dzikispecyficznemuskadowikwaswtuszczowychorazobecnoci skadnikwodziaaniuprzeciwutleniajcym tuszcz mlekowy jest stabilnyoksydacyjnie[20].Zewzgldunastosunkowomawartoenergetyczniduzawartobiakatwargjestbardzoprzydatnywrealizacjidiet,ktrychcelemjestredukcjamasyciaa[10,37].Bardzomaazawar-topurynsprawia,etwargjestzalecanywywieniuludzichorychnadnmoczanow[10,38].Wysokazawartoistrawnobiakatwarogupozwalanajegowykorzystywaniewcodziennymywieniuosbwwie-kupodeszymorazwdietachhiperalimentacyjnych,stosowanych wstanach niedoywienia biakowego[8].Jakociowyiilociowyniedobrbiakazmniejszaaktywnoenzymwmikrosomalnychwtroby,dlategozapewnienieodpowiedniejpodaypenowartociowegobiakajestbardzowanedladetoksykacjiorganizmu[39].Twargmoebyspoywanyprzezwikszoosbzezdiagnozowannadwraliwocipokarmownalaktoz.Wynikatozeznaczniemniejszejzawartocilaktozywporwnaniudomleka[22]orazobecnociegzogennejlaktazy(enzymuhydrolizujcegolaktozdoglukozyigalaktozy)[9].Niewielkailo laktozywdieciejestkorzystnadlazdrowialudzi,gdysprzyjanormalizacjimikrofloryjelitowejpodwzgldemskaduiliczebnoci.Powstajcykwasmlekowypodczasfermen-tacji laktozyprzezbakteriemlekowezakwasza trejelita,codziaaograniczajconarozwjniekorzystnejdlazdrowiamikroflory, sprzyja jegoregeneracjiorazpoprawiawchanianieniektrychskadnikwmine-ralnych,np.wapnia[10].


    Wysokaatrakcyjnoywieniowatwaroguwynikagwnie z jego stosunkowo maej wartoci energe-tycznej oraz duej zawarto penowartociowegobiakaobardzowysokiejstrawnoci.Dzikitymce-chomtwargjestbardzoprzydatnywywieniuludzizdrowychorazwrnychstanachniepatologicznych

  • 119Siemianowski K, Szpendowski J. Znaczenie twarogu w ywieniu czowieka

    i patologicznych organizmu. Wczenie twarogudo codziennej diety wzbogaca j rwnie w pewneiloci lekkostrawnego tuszczu zawierajcego wieleaktywnych biologicznie komponentw, niewielkieiloci laktozy, witaminy isole mineralne. W 2011rokustatystycznyPolakspoysumarycznie6,72kgproduktwzasortymentuserwtwarogowych[40].Majcnauwadzeduatrakcyjnoodywczilicznemoliwoci wykorzystywania twarogu w ywieniuczowieka jego spoycie jest zbyt mae. Celowym

    zatem byoby upowszechnianie wiedzy na tematwalorwywieniowychtwarogu,abyzwikszyjegokonsumpcj.Duzalettwarogujestatwoprzy-gotowanianajegobazieposikw.Twargmoebyspoywanysamodzielnie lubz rnymidodatkami,m.in.warzywami,owocami,ryb,przyprawami.Niebezznaczeniajestrwnieaspektekonomiczny,gdytwargstanowijednoznajtaszychrdepenowar-tociowego biaka zwierzcego spord dostpnychproduktwspoywczychnakrajowymrynku.

    1. Grska-WarsewiczH.Rozwjrynkuproduktwmleczarskich.PrzemSpo2005,10:20-23.

    2. Bohdziewicz K. Twarg pierwszy wiey ser wiata. PrzMlecz2009,2:4-8.

    3. HolanowskiA.Twarogiiserkitwarogowe.WydSpdzielcze,Warszawa1986.

    4. Rymaszewski J, mietana Z. Sery dojrzewajce i serytwarogowe. [w:] Mleczarstwo zagadnienia wybrane.ZiajkaS(red).Art,Olsztyn1997:151-239.

    5. mietanaZ,SzpendowskiJ,BohdziewiczK.Charakterystykatradycyjnegopolskiegotwaroguotrzymywanegowedugwasnejnowoczesnejtechnikiitechnologii.PrzMlecz2003,4:126-129.

    6. KolanowskiW.Odniadaniapodesery.Twarg.PrzGastron2003,10:22-23.

    7. GawckiJ.Rolabiakawywieniuiochroniezdrowia.[w:]Biakawywnociiywieniu.GawckiJ(red).AR,Pozna2003:93-104.

    8. Hryniewicki L, Roszkowski W. Biaka. [w:] ywienieczowieka. Podstawy nauki o ywieniu. Gawcki J (red).PWN,Warszawa2010:204-222.

    9. Zmarlicki S. Zdrowotne aspekty mleka i przetworwmlecznych.ZdrPubl2006,116(1):142-146.

    10. Kozikowski W, Przybyowicz K. Warto ywieniowaskadnikwmlekakrowiego.PrzMlecz1994,10:256-261.

    11. Szpendowski J i wsp. Technologia serw twarogowychopodwyszonejwartociodywczej.PrzMlecz2007,1:4-9.

    12. Juskiewicz J, et al. Physiological effects of the dietaryapplicationofquarkproducedwithenzymetransglutaminaseasasoleproteinsourceingrowingrats.IntDairyJ2012,26(2):155-161.

    13. NiteckaE,PopioekP.Wpywmetodykoagulacjimlekanazmiany wartoci odywczej biaka twarogw. Przem Spo1990,11:284-286.

    14. JaboskiE.Czynnikideterminujceimodyfikujcewartoodywcz biaka. Pediatr Wspcz Gastroenterol HepatolywienieDziecka2000,2:83-87.

    15. Szkidziowa W i wsp. Badania wartoci odywczejkrajowegomlekawproszku.III.Wpywogrzewaniamlekanastrawnoiwykorzystaniejegobiaka.PrzemSpo1970,1:7-10.

    16. Ziemlaski . Tuszcze w ywieniu czowieka nowekoncepcjeizalecenia.PrzemSpo1996,10:10-12.

    17. JensenRG.Thecompositionofbovinemilklipids.JDairySci2002,85(2):295-350.

    18. Cichon R, Kozikowski W. Tuszcz mlekowy w ywieniuczowieka.NowaMed1996,2:11-16.

    19. LipiskiKiwsp.Wpywsezonuprodukcjimlekanaprofilkwasw tuszczowych tuszczu mlekowego. ywn NaukTechnolJako2012,1(80):72-80.

    20. CichoszG.Prozdrowotnewaciwocituszczumlekowego.PrzMlecz2007,5:4-8.

    Pimiennictwo / References

    21. Gmez Candela C, Bermejo Lpez LM, Loria Kohen V.Importance of a balanced omega 6/omega 3 ratio for themaintenanceofhealth.Nutritionalrecommendations.NutrHosp2011,26(2):323-329.

    22. KunachowiczHiwsp.Tabeleskaduiwartociodywczejywnoci.PZWL,Warszawa2005.

    23. KusiukA,GrembeckaM,SzeferP.WzajemnerelacjesteCa i P w serach rdem prawidowo zbilansowanej diety.BromatChemToksykol2009,XLII(3):798-802.

    24. migielska H, Lewandowicz G, Gawcki J. Biopierwiastkiwywnoci.Przyswajalnoskadnikwmineralnych.PrzemSpo2005,7:28-32.

    25. migiel-Papiska D. Znaczenie prawidowego ywieniadzieci imodzieyzerodowiskzagroonychekologiczniewaspekcieprofilaktykiosteoporozy.MedRodz2002,17(1):42-45.

    26. JaboskiE.Mlekoijegoprzetworyniezastpionymrdemwapniawracjonalnymywieniu.PrzMlecz2001,2:62-64.

    27. JaroszMiwsp.Witaminy.[w:]Normyywieniadlapopulacjipolskiejnowelizacja.JaroszM(red).I,Warszawa2012:86-122.

    28. BiernatJ,WykaJ.Stanodywieniawaspekciestanuzdrowia.NowLek2011,80(3):209-212.

    29. MizeraK,PilisW.Znaczenieywieniawsportachsiowychwrnychfazachontogenezyczowieka.MedSportPract2008,9(4):73-84.

    30. HurasBiwsp.Zespwyniszczenianowotworowego.WspczOnkol2003,7(6):441-447.

    31. Bukowska B. Glutation: biosynteza, czynniki indukujceorazsteniewwybranychjednostkachchorobowych.MedPr2004,55(6):501-509.

    32. GsiorowskaD,KorzeniowskaK,JabeckaA.Homocysteina.FarmWsp2008,1:169-175.

    33. LiD.Chemistrybehingvegetarianism.JAgricFoodChem2011,59(3):777-784.

    34. DziubaB,DziubaM,IwaniakA.Milkproteinsasprecursorsofbioactivepeptides.ActaSciPolTechnolAliment2009,8(1):71-90.

    35. JklP,VapaataloH.Antihypertensivepeptidesfrommilkproteins.Pharm2010,3(1):251-272.

    36. MoskwaA,BozaskaP.Udzia serotoninywpatogeneziezespou jelita nadwraliwego. Wiad Lek 2007, 60(7-8):371-376.

    37. JaroszM,GrodowskaA.Leczenieotyoci.FamMedPrimCareRev2008,10(4):1361-1366.

    38. Majdan M, Borys O. Dna i schorzenia towarzyszcepodwyszonemusteniukwasumoczowego.AnnAcadMedStetin2010,56(Suppl.1):34-39.

    39. KorzeniowskaK,JabeckaA.InterakcjelekwzpoywieniemFarmWspcz2008,1:24-30.

    40. wietlikK.Spoyciemlekaijegoprzetworw.Rynekmleka:staniperspektywy2013,44:13-17.